(data stored in ACNUC29543 zone)

EMBL: CT978603.PE509

CT978603.PE509       Location/Qualifiers
FT   CDS_pept        462377..462535
FT                   /transl_table=11
FT                   /gene="SynRCC307_0509"
FT                   /locus_tag="SynRCC307_0509"
FT                   /product="Uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27412"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA3"
FT                   /protein_id="CAK27412.1"
FT                   /translation="MTRRTPYGAFSVLALVIFAIAAVIMATTTGRWEQEALEKQPDFQD
FT                   QPTLPAN"
     atgactcggc ggactcccta cggggcgttt tccgttttgg ccttggtgat cttcgcgatt        60
     gccgccgtga tcatggccac aacgacaggt cgctgggagc aagaagccct ggagaagcag       120
     cctgattttc aagatcagcc aaccctgcca gcgaactaa                              159
//

If you have problems or comments...

PBIL Back to PBIL home page