(data stored in ACNUC29543 zone)

EMBL: CT978603.PE51

CT978603.PE51        Location/Qualifiers
FT   CDS_pept        47613..47825
FT                   /transl_table=11
FT                   /gene="SynRCC307_0051"
FT                   /locus_tag="SynRCC307_0051"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26954"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ5"
FT                   /protein_id="CAK26954.1"
FT                   /translation="MAEPSTNPWLSLGMQLMDVARQKLATPAEPVVPVEVTVEDPDEPA
FT                   SVEALQERLTAIAARLQQLEAKLLP"
     atggctgaac cttccaccaa tccctggctc agtcttggca tgcagctcat ggacgttgcg        60
     cgccagaagt tggcgacgcc tgcagagccg gtggtgcctg ttgaggtgac ggtggaagat       120
     cctgatgagc cggccagtgt cgaggcactg caagagcgcc tgacggccat cgctgcgcgg       180
     ctgcagcaac tggaggccaa gctgctgcca tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page