(data stored in ACNUC29543 zone)

EMBL: CT978603.PE510

CT978603.PE510       Location/Qualifiers
FT   CDS_pept        462923..463093
FT                   /transl_table=11
FT                   /gene="SynRCC307_0510"
FT                   /locus_tag="SynRCC307_0510"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27413"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA4"
FT                   /protein_id="CAK27413.1"
FT                   /translation="MAKVIPLFPGRPPGGLDRSERLDDLRCRLADQEAAIKALNDQLHE
FT                   LVFCLLTREPA"
     atggccaagg tcattccgtt gtttcctggc agacctccag gtgggctgga tcgctctgag        60
     cggcttgacg atcttcgctg ccgcttggct gatcaagagg cagccatcaa agccctcaac       120
     gatcagctgc atgagttggt gttttgcctg ttaacccgtg agcctgctta a                171
//

If you have problems or comments...

PBIL Back to PBIL home page