(data stored in ACNUC29543 zone)

EMBL: CT978603.PE511

CT978603.PE511       Location/Qualifiers
FT   CDS_pept        complement(463202..463453)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0511"
FT                   /locus_tag="SynRCC307_0511"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27414"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA5"
FT                   /protein_id="CAK27414.1"
FT                   /translation="MDQSLATASTRFNLKSLVHSEVPMERQPSDIRQTLFFSASSMGVE
FT                   AIDDCEQTFANDPSQAIAGLGAAVVSWCVMVERALWMI"
     atggatcagt cgcttgcaac agccagcacg cgattcaacc tgaaatcact ggttcattcc        60
     gaggtgccca tggagcgcca accttccgac atccggcaaa cacttttttt cagcgcgagc       120
     tccatgggtg ttgaagccat cgacgattgc gagcagacat ttgccaacga ccccagccag       180
     gccattgctg gcctcggcgc cgccgtggtg agctggtgcg tgatggttga gcgggccctc       240
     tggatgatct ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page