(data stored in ACNUC29543 zone)

EMBL: CT978603.PE513

CT978603.PE513       Location/Qualifiers
FT   CDS_pept        463971..464240
FT                   /transl_table=11
FT                   /gene="SynRCC307_0513"
FT                   /locus_tag="SynRCC307_0513"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27416"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA7"
FT                   /protein_id="CAK27416.1"
FT                   /translation="MNNPQAIPTSICAAGALLREVIQNQLHELEPLQRSKLQLALRPDC
FT                   MSEAMKESLALAVREIHGFTQHTTANLFEAVLDCGEEQEPTPGS"
     atgaacaacc cccaagccat ccccacctcc atctgcgctg ctggcgccct actgcgcgag        60
     gtgatccaaa accagctcca tgagctcgag ccgttgcagc gcagcaagtt gcaattggcg       120
     ttgcggcctg actgcatgtc ggaagccatg aaggaatcac tggctctcgc agtccgcgag       180
     attcatggat tcacacagca caccacagcc aacttgtttg aagcggtgct cgattgcggc       240
     gaggagcagg agccaacccc tggcagttga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page