(data stored in ACNUC29543 zone)

EMBL: CT978603.PE514

CT978603.PE514       Location/Qualifiers
FT   CDS_pept        464299..464646
FT                   /transl_table=11
FT                   /gene="SynRCC307_0514"
FT                   /locus_tag="SynRCC307_0514"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRA8"
FT                   /protein_id="CAK27417.1"
FT                   /translation="MPESGPDPYVQFLENWIPGIGECTELHDKLHEHFELDFSVNSEAR
FT                   LLGFQLGHHPAGNFLHVMIFAVISTLLYPSPYRNDWSGLRDFFRSYVLGKNFQLISYWF
FT                   IPRGILAWRSL"
     atgccggagt caggtcctga tccctatgtg caatttctcg agaactggat tcctggcatt        60
     ggcgagtgca cagagctgca cgacaaactc cacgaacact ttgaacttga tttcagtgtc       120
     aacagcgaag cccggttgct ggggtttcag ctgggccatc accccgccgg caattttctg       180
     cacgtgatga tttttgctgt gatcagcacc cttctgtacc ccagtcctta tcgcaatgac       240
     tggtcaggtc tgagggactt ttttcgttcc tatgtgttgg gcaaaaattt tcagctcatt       300
     tcctattggt tcatcccgag ggggatcctg gcttggcgga gcttatga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page