(data stored in ACNUC29543 zone)

EMBL: CT978603.PE516

CT978603.PE516       Location/Qualifiers
FT   CDS_pept        465067..465327
FT                   /transl_table=11
FT                   /gene="SynRCC307_0516"
FT                   /locus_tag="SynRCC307_0516"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27419"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB0"
FT                   /protein_id="CAK27419.1"
FT                   /translation="MNNVSPSAAEAIAGALFAKSIDDCLEGLNDAERFKASMALKQVYM
FT                   SEQTRSRLNQAVQEVNELALSRAAVFIDGLLDGDKEEITPL"
     atgaacaacg tttctccctc ggctgcggag gccattgctg gtgccctgtt cgccaaatcc        60
     attgacgatt gcctcgaggg cttgaacgat gccgagcgct tcaaggcatc gatggctttg       120
     aagcaggtct atatgtctga gcagacccgc tcacgcctca accaagccgt gcaagaagtc       180
     aacgagctgg cgctcagccg cgcggcggtg ttcatcgatg gcttgttgga tggcgacaag       240
     gaagagatca caccgctgta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page