(data stored in ACNUC29543 zone)

EMBL: CT978603.PE517

CT978603.PE517       Location/Qualifiers
FT   CDS_pept        465393..465851
FT                   /transl_table=11
FT                   /gene="SynRCC307_0517"
FT                   /locus_tag="SynRCC307_0517"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27420"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB1"
FT                   /protein_id="CAK27420.1"
FT                   /translation="MGASDVLIGDLAMKTASSIGIGCLAVAAAFFSLELLTATASASPT
FT                   AGPMRIATTPLLLWRRQEQLSDQQREALFQAQRRWKQTSYSSRAALMQQEKQCVDRATS
FT                   KLAFKRCLKQTRQSRSALREQYYAYINPIRQELGLAPLEWVERRSPRR"
     gtgggagcgt cggatgtctt gattggggat ctcgccatga aaacggcttc atcgattggc        60
     attggttgtt tggctgttgc agcggctttt ttcagccttg agctgttgac tgccaccgca       120
     tccgcctctc caacggctgg ccccatgcgc atcgccacaa cgccgctgtt gctgtggagg       180
     cgccaagagc aattgagtga tcagcagcgc gaggccctgt ttcaagccca aaggcgctgg       240
     aagcaaacca gctactccag ccgtgctgcg ttgatgcagc aggagaagca atgcgtggac       300
     cgcgccacaa gcaaactggc cttcaagcgt tgcctcaaac aaacccgtca gtcccgctcg       360
     gccttgcgcg agcagtacta cgcctacatc aatccgatca ggcaagaatt gggcttggct       420
     cctttggagt gggttgagcg ccgctcaccc aggcgctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page