(data stored in ACNUC29543 zone)

EMBL: CT978603.PE52

CT978603.PE52        Location/Qualifiers
FT   CDS_pept        47822..49621
FT                   /transl_table=11
FT                   /gene="SynRCC307_0052"
FT                   /locus_tag="SynRCC307_0052"
FT                   /product="Cell division protein FtsI / penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26955"
FT                   /db_xref="GOA:A5GPZ6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPZ6"
FT                   /protein_id="CAK26955.1"
FT                   /translation="MSLGFSRRDARFCGMGQQPGVILLVLLMFFSAIGMRLVWMQLLHG
FT                   AENRVAADENRIRLMPRSPIRGRLLDRKGRVLASSKLTYTLFIEPRLVTDEQWPALRDR
FT                   LAALLQLDPKGLDQARERGTGKDGYRIPLVNGLQPEQVLRFQEQNLDLPGASVDMDILR
FT                   YYPHGMLASHTLGYTQPITEDEYDVLIDKGYKIRDRIGRIGVEAAYESHLRGKWGGQML
FT                   EVNANGEVQRYLGDRPSKAGKDLILTIDLDLQRAAEKALADKRGGAIVAMNPTTGAILA
FT                   MASKPNFDPNFFSKLITTQQEYDALFKSPNKPLFSRAMNAYNPGSTWKVVTGMAGMESG
FT                   KFPAGTKLQTMGCITYGGHCFPDHNGAGFGTIGYEDALRFSSNTFFYQVGVGVGSRELY
FT                   KSAKLLGFDAPSGIEIGYEESPGLVGNEDWANEGRGWAEPGTTPWIPEDMASASIGQSI
FT                   VEITPLQLARAYSVFANGGYLVTPHLADQGQDWTAPPLRTKVDMKPSTLETIRAGLRKV
FT                   VADGTGYGLNDPALPPGAGKTGTAEDSQRGGPDHAWFGCFSPYDNPEIVVAAFAQNTPG
FT                   GGSVHALPMAKKVLLAWHAQKAD"
     atgagcctcg gtttctcccg ccgtgatgcc cgcttctgcg gcatgggaca gcagcccggc        60
     gtgatcctgc tggtgctgtt gatgtttttc agcgccatcg gcatgcggct ggtgtggatg       120
     caattgctcc acggcgctga gaatcgcgtt gctgctgatg agaaccgcat ccgtttgatg       180
     ccccgctccc ccatccgcgg tcggttgctt gaccgcaagg gacgtgtgct ggccagcagc       240
     aaactcacct acacactttt cattgagcct cggctggtca ctgatgagca atggccggcc       300
     ttgcgggatc gcttggcggc tttactgcag ctggatccca agggcctcga tcaagcgcgc       360
     gagcgcggca ccggcaaaga cggttatcgg atcccgttgg tgaatggact gcagcccgag       420
     caggtgctgc gttttcaaga gcagaacctc gatctgcctg gcgccagcgt ggatatggac       480
     atcctgcgct actaccccca cgggatgttg gcgtcccaca cgttgggcta cacccagccg       540
     atcactgagg atgaatacga cgtcttgatt gataagggct acaagatccg cgatcggatt       600
     ggccgtatcg gcgtggaagc ggcctacgaa agccatctgc gcggcaaatg gggcggtcag       660
     atgttggagg tgaacgcgaa cggtgaggtg cagcgctatc tgggtgatcg cccctccaag       720
     gccggaaaag acctcatact cacgatcgat ttggatctgc aacgggctgc agagaaggcc       780
     ctcgccgaca agcgtggtgg cgccatcgtg gccatgaacc ccaccaccgg ggcgattctg       840
     gcgatggcca gcaagcccaa tttcgatccc aactttttct ccaagctgat caccacccag       900
     caggaatacg acgccctctt taagtcgccg aataagccgc tctttagccg ggcgatgaat       960
     gcctacaacc caggcagcac ttggaaagtg gtgactggta tggcgggtat ggaatcgggc      1020
     aagttccctg ctggcaccaa gcttcagacc atgggatgca tcacctatgg cggccactgc      1080
     ttcccggatc acaacggcgc cggttttggc accatcggct acgaagatgc gctgcgcttc      1140
     tccagcaaca ccttcttcta tcaagtgggt gttggtgtgg gttcccgtga gctctacaaa      1200
     tcagccaagc tcttgggttt tgacgctccc agcgggattg agatcggcta cgaggagagc      1260
     cctggtttgg tgggcaatga agattgggcc aacgaaggtc gtggttgggc ggaacctgga      1320
     accacccctt ggattccaga agacatggct tcagcctcca ttggccagtc gattgttgag      1380
     atcacgccat tgcaattggc ccgcgcctac agcgtgtttg ccaatggcgg ttacttggtg      1440
     actccacacc tggctgatca aggacaggat tggacggctc cgccgctgcg caccaaggtg      1500
     gacatgaagc ccagcacctt ggagaccatt cgcgctggcc tgcgcaaagt ggtggccgat      1560
     ggcacggggt atggcctcaa tgatcctgca ctcccccctg gggctggcaa aacaggaaca      1620
     gcagaagaca gccaacgggg cggtccggac catgcctggt ttggctgttt ctctccctac      1680
     gacaaccctg aaatcgtggt ggccgccttt gcgcagaaca ccccaggcgg tggatcagtg      1740
     catgccctgc cgatggccaa aaaggttctt ttggcctggc atgcgcagaa agctgattga      1800
//

If you have problems or comments...

PBIL Back to PBIL home page