(data stored in ACNUC29543 zone)

EMBL: CT978603.PE521

CT978603.PE521       Location/Qualifiers
FT   CDS_pept        complement(466610..466828)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0521"
FT                   /locus_tag="SynRCC307_0521"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRB5"
FT                   /protein_id="CAK27424.1"
FT                   /translation="MTERNSDRLPHCGWVYGKGQPPQPFLITATNADGSAVGYRAGNNQ
FT                   TIPAGEWFFELPASDEDQVQWAELLGH"
     atgactgagc gcaacagcga tcgactgccg cattgcggct gggtgtacgg caaggggcaa        60
     ccgcctcagc cgtttctgat cacggccacc aatgccgatg gctcagcggt tggctaccgc       120
     gcaggcaaca accaaaccat cccagctggg gaatggtttt ttgaactgcc agccagcgat       180
     gaagaccaag ttcagtgggc tgaattgttg ggtcactaa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page