(data stored in ACNUC29543 zone)

EMBL: CT978603.PE528

CT978603.PE528       Location/Qualifiers
FT   CDS_pept        470676..470921
FT                   /transl_table=11
FT                   /gene="SynRCC307_0528"
FT                   /locus_tag="SynRCC307_0528"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27431"
FT                   /db_xref="GOA:A5GRC2"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC2"
FT                   /protein_id="CAK27431.1"
FT                   /translation="MTASLTNQFGTVGSAGSIRSSGGWQAPMDWNDDALAALKKDVPFF
FT                   VRPAVRRRVESMAAEENRPSIDLSFYQQAKASMGPK"
     ttgaccgctt cgttgaccaa tcaatttgga acggttggtt ccgctggatc gataaggtcc        60
     agtggcggat ggcaggctcc gatggactgg aatgacgatg ctttggcagc cctgaagaag       120
     gacgtcccct tttttgtgag gccagcagtg cgccggcgtg tggagtccat ggctgctgag       180
     gagaaccgac catccatcga cctgagcttc tatcaacagg ccaaagccag catggggccg       240
     aagtga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page