(data stored in ACNUC29543 zone)

EMBL: CT978603.PE530

CT978603.PE530       Location/Qualifiers
FT   CDS_pept        471437..471754
FT                   /transl_table=11
FT                   /gene="SynRCC307_0530"
FT                   /locus_tag="SynRCC307_0530"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27433"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRC4"
FT                   /protein_id="CAK27433.1"
FT                   /translation="MGKALMRPLVIAFTTVLSAAPAQAEIVQAWCSLMWRDGRAQIEQG
FT                   PCDFRQAFGNVQVWMGERWAFDFPADGQGRYYTRRNRNDFIRFERGGYILTVFQGGQPA
FT                   R"
     atgggcaaag cgctaatgag gcctcttgtg attgctttca ccacggttct cagcgcagca        60
     ccggctcagg ctgaaattgt tcaagcctgg tgctcattga tgtggcggga tggtcgtgca       120
     cagatcgaac aaggcccttg cgacttccgg caagcgtttg gcaacgttca ggtttggatg       180
     ggcgagcgct gggcgtttga ctttccagcg gatggtcagg gccgctacta cacccgcaga       240
     aaccgcaacg acttcatccg ttttgagcgt ggtggctaca tcctcacggt gttccagggc       300
     ggtcagccag ctaggtaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page