(data stored in ACNUC29543 zone)

EMBL: CT978603.PE537

CT978603.PE537       Location/Qualifiers
FT   CDS_pept        complement(474771..474950)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0537"
FT                   /locus_tag="SynRCC307_0537"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27440"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD1"
FT                   /protein_id="CAK27440.1"
FT                   /translation="MSNEMSPIKLTDAPDGFEYYKVCDPQGVCRVVRGFQEAQRVMKET
FT                   PGLTATKLPGAKAT"
     ttgagcaatg aaatgagtcc gatcaagctc accgatgctc cagatggctt tgagtactac        60
     aaggtctgcg acccacaggg cgtttgccgc gtggtcagag ggttccaaga agcccagcgg       120
     gtcatgaaag agacgcctgg cctgactgcc accaagctgc cgggcgccaa agccacctaa       180
//

If you have problems or comments...

PBIL Back to PBIL home page