(data stored in ACNUC29543 zone)

EMBL: CT978603.PE538

CT978603.PE538       Location/Qualifiers
FT   CDS_pept        complement(475473..476315)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0538"
FT                   /locus_tag="SynRCC307_0538"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27441"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD2"
FT                   /protein_id="CAK27441.1"
FT                   /translation="MPPTDGLPQLSRRERTVLDDNPWFIDGCQVYARQNLQARHDRHLI
FT                   AAAYAREGYSVQPIEREATTLERQRCSTQKAQTDAANEREAGRVADASPPSDDQSPEAS
FT                   AATRKKDQICNRFNIVPAELTTQHVLDIGNAFPALRNRLLYDNTTALGLFTHGRLKQLG
FT                   DAYVLDRVRIAKLHLQLHWIKQLTTEACAADLLTSKDWFSANDAWVKLSHRLVMEDSCA
FT                   KRYPSRRHSASAVLSALCRQFCASLASARKQSRSGLVGKSFVFTASQARCTTSPLPRC"
     atgccgccga cagatggcct gccgcaactg tcccgtcgag aaaggacggt cttagacgac        60
     aacccttggt tcatcgatgg gtgtcaggtg tacgcccgtc agaaccttca ggcccgccac       120
     gatcgccatc tgattgcagc cgcttacgca cgagagggct attcggtcca gccaatcgaa       180
     cgcgaagcca ccacgctgga gcgccagcgg tgttcaacac agaaggccca gacggacgcc       240
     gccaacgaaa gagaagcggg ccgcgtggca gacgcttctc caccctcaga cgatcagtca       300
     ccggaagcga gtgccgcaac caggaagaaa gaccaaatct gcaatcgctt caatatcgtc       360
     cctgcggaat tgaccaccca acatgtactc gacataggca acgcgttccc cgctttgagg       420
     aatcggctgc tgtacgacaa cacgaccgcg cttggcttgt ttactcatgg ccggttaaaa       480
     caattagggg acgcttacgt cctagaccga gtgcgcattg ccaaattgca tctacagctg       540
     cattggataa aacaactgac taccgaagcc tgtgccgcag atttactcac cagcaaggac       600
     tggtttagtg ccaacgacgc ctgggtgaag ctttcacatc gactggtgat ggaagattcc       660
     tgtgccaagc gatacccaag cagaagacac tcagcttcag ctgtcctatc ggcgttgtgc       720
     aggcaattct gtgcatcttt ggcttcggca aggaaacaaa gcagaagcgg gttagtggga       780
     aagtcgttcg tcttcacagc atcacaggcc cgttgcacca cttcgccact accaaggtgc       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page