(data stored in ACNUC29543 zone)

EMBL: CT978603.PE539

CT978603.PE539       Location/Qualifiers
FT   CDS_pept        476582..477352
FT                   /transl_table=11
FT                   /gene="SynRCC307_0539"
FT                   /locus_tag="SynRCC307_0539"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27442"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRD3"
FT                   /protein_id="CAK27442.1"
FT                   /translation="MAPARLSDSQKQELVSQFKAGVTAAALAEAFGCSPNTVSRTVKAL
FT                   LSPEEYEGLKQKRSGRGTAAVAVKEDEPKADEPETETAPEAPSPEAELEADEPLEGSSS
FT                   LALDDADDFGADDSDEELDELSDDDSVAETFVAIAPLPGLGVIDGGAPCVSKPLVDGSL
FT                   PSTVYLLVDRDVELKGTPVKDFSELGAVAATEMEHKAIALFSNPRQAKRQCGRSQRVIK
FT                   VPDSGVFGRTAPFILAQGISRIVLEGSLYAIPGA"
     atggccccgg cccgcctcag cgacagccag aagcaggagc tggtgagcca gttcaaggct        60
     ggcgtgacag cggcggcgct tgccgaagcg tttggctgca gccccaacac ggtgagccgc       120
     accgtgaaag ctctgctcag ccccgaggag tacgaaggcc tcaagcagaa gcgcagtggc       180
     cgcggcactg ctgctgttgc ggtgaaagaa gacgagccca aggcagacga acccgaaact       240
     gagaccgcac cagaggcccc ttcccctgag gctgaactag aagctgatga gccgctggag       300
     ggcagtagct ctttggccct tgatgacgcc gatgatttcg gcgctgatga cagcgacgag       360
     gagcttgatg agctcagcga cgacgacagc gttgctgaaa cctttgtggc gattgccccg       420
     ctgcctggtc tcggggtgat tgatggcggg gccccttgcg tcagtaagcc gctggtggat       480
     ggaagcttgc cttccacggt gtatctgttg gtcgaccgcg acgtggagct caaaggcacc       540
     cccgttaaag acttcagcga gctgggtgct gtggcggcca ctgagatgga gcacaaggcg       600
     attgcgctgt tcagcaatcc ccgccaggcc aagcgacagt gtggccgcag tcagcgggtg       660
     atcaaggtgc cggattccgg cgtctttggc cgcaccgcgc cattcatcct ggcccagggc       720
     atcagccgta tcgttttaga aggcagcctc tacgccatcc ctggcgcttg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page