(data stored in ACNUC29543 zone)

EMBL: CT978603.PE555

CT978603.PE555       Location/Qualifiers
FT   CDS_pept        492081..492554
FT                   /transl_table=11
FT                   /gene="SynRCC307_0555"
FT                   /locus_tag="SynRCC307_0555"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27458"
FT                   /db_xref="GOA:A5GRE9"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRE9"
FT                   /protein_id="CAK27458.1"
FT                   /translation="MSLVELLTAVAIVGILAGTSINASRRPLAHQQLLAAARQLELGIE
FT                   QARDQAMDQQAPCALALGEAGWIAPQDGSLPACSDAVSPLLAGDRANGLRLNHNITALQ
FT                   FTANGLVLGGGTVRLAVDGLDQERCVVISLPLGITRRGLWENSQCVPPASAES"
     atgagcttgg ttgagctgct cactgctgtg gcgattgtgg ggatcctggc gggcaccagc        60
     atcaacgcca gccgcaggcc gcttgcccat cagcagttgc tggccgcggc gcgtcaactg       120
     gagctgggca ttgagcaagc ccgcgatcag gcgatggatc aacaggcccc ctgcgctctg       180
     gcgttagggg aggccggttg gattgcacct caagatggca gcttgcccgc ctgcagcgat       240
     gccgttagcc cattgctcgc gggtgatcgc gccaatggcc tgaggctgaa tcacaacatc       300
     acggcgctgc agttcaccgc caatggcttg gtgctggggg gcggcaccgt gcgcttagcg       360
     gtggatggtt tggatcaaga acgctgtgtg gtgatcagct tgccgctggg catcacacgc       420
     cgaggccttt gggaaaacag tcaatgtgtg ccgccagcgt cagcagaatc ttga             474
//

If you have problems or comments...

PBIL Back to PBIL home page