(data stored in ACNUC29543 zone)

EMBL: CT978603.PE558

CT978603.PE558       Location/Qualifiers
FT   CDS_pept        complement(494504..495127)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0558"
FT                   /locus_tag="SynRCC307_0558"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27461"
FT                   /db_xref="GOA:A5GRF2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF2"
FT                   /protein_id="CAK27461.1"
FT                   /translation="MLYNSQSMRSNKAGFTLVELLVVTIIISLGLKWSLPGLIRSAKQS
FT                   EVDNYTQIVESGLFSLQAKVGKTKSSCEINFGSSNQFKAPWEILEFQQPSGTQAFLNER
FT                   ISCCNSKEGCVGGPEYRLISREGMQDRNAVEISTSKPFFEISPPGTSAEASILTILIRS
FT                   KSHDLQSLKNKSGKSRLKIRCVEISGSGNISNGTWSEESEKCLI"
     atgttataca acagccaatc catgagaagc aataaggcag ggtttactct ggtagaatta        60
     ttagtggtga cgattataat atcgctaggc ttaaagtgga gccttcctgg tttaattcga       120
     tctgcaaagc aaagtgaagt tgataattac acccaaatag ttgagtcagg cctcttcagt       180
     ctgcaagcaa aagtaggcaa gacaaaatca agctgtgaaa taaattttgg gagctctaac       240
     caattcaaag ctccttggga gatcttggag tttcaacaac ctagcggaac acaagcattt       300
     ctaaatgaac gtatttcatg ctgtaattcg aaagaggggt gtgttggtgg gccagagtat       360
     cgattaatca gcagagaagg gatgcaagac agaaatgctg ttgagatttc aacttcaaag       420
     ccattttttg aaataagccc tcccggaaca agcgctgaag cgagtatctt aacaattctg       480
     atacgctcca aaagtcatga cctccaatcc cttaagaaca agtcaggaaa gagcaggtta       540
     aaaatacgct gcgtagaaat ttctggcagt ggcaatatca gcaacgggac ttggagcgaa       600
     gaatcagaaa aatgcttaat ataa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page