(data stored in ACNUC29543 zone)

EMBL: CT978603.PE559

CT978603.PE559       Location/Qualifiers
FT   CDS_pept        complement(495291..495632)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0559"
FT                   /locus_tag="SynRCC307_0559"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27462"
FT                   /db_xref="GOA:A5GRF3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF3"
FT                   /protein_id="CAK27462.1"
FT                   /translation="MHSRITAYLSSKVSSDPEGFTLVEVLVAGILMAGIMIGVSRLSTS
FT                   ALASSAKQAERQRIEASISNNIQMLQMEDSYLRFEDMSNEQQVRGCKNPTMELEAHLSQ
FT                   KVPAPDHQA"
     atgcatagtc gtataacagc atatctgagc tcgaaagttt cgagtgatcc tgagggcttc        60
     acactcgtag aggttttggt ggctggtatt ctcatggcag gaataatgat tggtgtaagc       120
     cgactcagca cttcggcatt agcaagcagt gctaaacaag ctgaacgtca acgaatcgag       180
     gcttcgataa gcaacaatat tcagatgctg caaatggagg actcatatct acgctttgaa       240
     gatatgagca atgaacagca agtacgtgga tgcaaaaatc caacaatgga actagaggct       300
     catctttctc aaaaagttcc agctccagac caccaggcgt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page