(data stored in ACNUC29543 zone)

EMBL: CT978603.PE560

CT978603.PE560       Location/Qualifiers
FT   CDS_pept        complement(495745..497481)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0560"
FT                   /locus_tag="SynRCC307_0560"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27463"
FT                   /db_xref="GOA:A5GRF4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF4"
FT                   /protein_id="CAK27463.1"
FT                   /translation="MKLYLETKNLQPQNQALFALHKLAAMVRHSPKTAKSEQGMALAMT
FT                   LMMGLLLVAGSGALVSKITMNRRIGASKSYQQMAQSAAINGFNRVLGIVNKDDDDNYRG
FT                   YYLQLNNNEGDPEIDGDESWDWETVNNDPRPNPLQELCTDTTVGMPTNWPRDSIKISSE
FT                   TQRNDGQGDVNLAYRLRNYSVLNGGEKSIGTFEIEGFVTRGDGESDGNYLARTLLTRSL
FT                   YVESKVVAEGDWGVMAGNYMQLGQSKITDSSNNQKNSGLILLEIEDPSDYQSAASCTPG
FT                   NRATAVGSYDDDLGNKVWPIWNRKLPLTSLFTKANLVDQIDGSPRIWSFDDSPEDPDPE
FT                   KNPGSLAFQQKCPNSIVCTRKTNNDIFAVPERVTLDQSDNTNTVIIGSDVLCEGQDGFE
FT                   CHVFIEHLNLSTTTVLIDNKDRPIVIHLERPQGDNVSSNLSGQIKLTGSSKLCGTSDGE
FT                   TCNKQPERFVITANAGQAGMDCDSTTHVLSVEGSNLPHAFIHLPRGTVRTTGNAILHGV
FT                   IWAHSICAQEGGIHLITEENQKTVVRAADELWEWSKNGFPGFGRMVTRGIRGTEFDTFQ
FT                   RW"
     gtgaaattat atctggaaac aaaaaacttg cagcctcaaa atcaagcctt gtttgctcta        60
     cataagttag cagccatggt gaggcacagc ccaaaaacag caaaaagcga gcagggcatg       120
     gctctagcaa tgaccttgat gatgggcctc ttgctagttg ctggatcagg cgccttggtg       180
     agcaagatca ccatgaacag aagaatagga gcttcaaaga gctatcaaca gatggctcaa       240
     tcagccgcaa tcaatggctt caatagagtc ctaggcattg tcaacaagga tgatgacgat       300
     aactacagag gatattattt gcagcttaat aataatgaag gcgatccaga aattgacgga       360
     gatgaaagct gggactggga gaccgtcaat aatgacccaa ggccaaatcc attacaagaa       420
     ctatgcactg acacaactgt cggcatgcca acaaattggc caagggacag cattaaaatc       480
     tcctcagaaa cccaacgcaa tgatggccag ggcgatgtca atctggcata tcgcctcaga       540
     aactactccg tccttaatgg aggtgaaaag agtattggca cattcgagat agagggattt       600
     gttacgcgtg gcgatggtga aagcgatggc aactatctag ccagaacttt gctaacacgg       660
     tcgctttatg ttgagtcaaa agttgtagcg gagggtgact ggggtgtcat ggccggcaac       720
     tatatgcaat taggacaatc aaaaataaca gacagtagca acaatcagaa aaattctggg       780
     ctaattctat tagaaattga agacccttca gactatcaat cggctgctag ctgtactcct       840
     ggcaatcgag caacagcagt aggttcgtat gatgatgatc ttggcaacaa ggtttggcct       900
     atctggaaca ggaagcttcc acttaccagc ctatttacaa aagcaaattt agttgatcaa       960
     attgatggtt caccaagaat atggagcttt gatgacagcc cagaagatcc tgatcccgag      1020
     aaaaatccag gcagtcttgc ttttcaacaa aaatgtccaa actcaattgt gtgtactcga      1080
     aaaaccaaca acgatatttt tgccgtacca gaaagagtca cattagatca atcagacaat      1140
     actaatactg ttatcatagg ctcagatgta ctttgtgaag gtcaagacgg atttgaatgc      1200
     catgtcttca ttgagcacct aaatctttcg acaactactg tgttgattga caataaagac      1260
     aggcctattg tcattcacct agaaagacca cagggagata acgtgtctag caacttgagc      1320
     ggtcaaatca agctcacagg ttctagcaag ctatgtggaa cttcagatgg tgaaacctgt      1380
     aataagcagc ctgaacgctt cgtcataaca gctaatgcgg ggcaagcagg aatggactgc      1440
     gattcaacaa cacacgttct cagcgttgag gggagcaatc ttcctcacgc atttatccat      1500
     ctgccacgcg gaacagttcg aacaacagga aacgcaatac ttcatggtgt aatctgggct      1560
     catagtattt gtgctcaaga agggggcatt catttaataa cagaagagaa tcaaaaaaca      1620
     gttgtacgtg cagcagatga actctgggag tggagtaaaa atggatttcc tggctttgga      1680
     cgcatggtaa ctcgcggaat ccgtggaaca gagtttgata cattccaacg atggtaa         1737
//

If you have problems or comments...

PBIL Back to PBIL home page