(data stored in ACNUC29543 zone)

EMBL: CT978603.PE564

CT978603.PE564       Location/Qualifiers
FT   CDS_pept        499459..499854
FT                   /transl_table=11
FT                   /gene="SynRCC307_0564"
FT                   /locus_tag="SynRCC307_0564"
FT                   /product="Putative PAS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27467"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF8"
FT                   /protein_id="CAK27467.1"
FT                   /translation="MAEQWTPGAVAALREKENLPFVRADARGNIVEFNARFAEVYGWVE
FT                   GQLVGESISAILPPSFREFHHAGFARFQLTESSKVVGHPLTLATVCSDGSEVQSEHYIV
FT                   AEKYPDGSWSFAATLRPLEGEHASDQE"
     atggcggagc agtggactcc aggcgctgtt gcggccctgc gcgaaaagga aaacttgccc        60
     tttgtgcgtg ctgatgccag aggcaacatc gttgagttca atgcccgttt tgcggaggtg       120
     tatggctggg ttgagggtca gctggtcggt gaatccattt cagcgatcct gccgcccagc       180
     tttcgagaat ttcatcacgc cggctttgct cgctttcagc tgactgaaag ttccaaggtg       240
     gtgggccatc cactcaccct ggccacggtc tgcagcgatg gcagtgaagt gcaaagcgag       300
     cactacatcg ttgctgagaa atatcccgat ggcagttgga gctttgccgc cacattgcgg       360
     ccattggaag gtgagcacgc ttcagatcag gaatga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page