(data stored in ACNUC29543 zone)

EMBL: CT978603.PE565

CT978603.PE565       Location/Qualifiers
FT   CDS_pept        499851..500942
FT                   /transl_table=11
FT                   /gene="SynRCC307_0565"
FT                   /locus_tag="SynRCC307_0565"
FT                   /product="Two-component system sensor histidine kinase"
FT                   /note="Signal transduction mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27468"
FT                   /db_xref="GOA:A5GRF9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRF9"
FT                   /protein_id="CAK27468.1"
FT                   /translation="MSEEATLAQLRQSLGLLQVAFDAAAEAMVIVEPGGEVRWGNQAAA
FT                   DLWSNGLAILLVGQRLEQLLQPICSSSGVPLALEAAEHPLQLLKRGDGSGVFGIADHLQ
FT                   QLEWRRIQQPGDGYLLLLARDLAPQEQALQQQRQFVNQLAHELNTPLAIVNGSLRQLGK
FT                   KLLNFGDGSRERLRQAQQETSRLVRLLRHLLVLTDLETGRRQLQLQPLALKPWLQEWMA
FT                   QQVLPASAELNLVADVGESAVIAADAEALAEVLEQLLDNSLRYSKGPAQIELQLLELDG
FT                   ASGLRWQDQGLGITAEPRSQVFERFVRLEEHRDFNQADGAGLGLALCEALMQAMGGSTG
FT                   LEPITNESTGTAFLLSWPQAGGK"
     atgagtgagg aggccacgct ggctcagttg cgccagtcgc ttggcctgct gcaggtggcg        60
     tttgatgcgg cagcagaggc gatggtgatt gttgagcctg gcggggaggt gcgttggggg       120
     aatcaagccg ccgccgatct ttggtccaat ggcttggcga tcctgttggt gggccagcgg       180
     ttggagcagt tgcttcaacc catctgcagc agcagcggtg tgccgttagc tcttgaggct       240
     gccgagcatc cgctgcaact cctcaagcgt ggggatggct caggtgtttt tggaatcgct       300
     gatcatttgc agcagttgga gtggcggcgg attcagcagc ctggcgatgg ctacctgttg       360
     ctgttggcgc gtgatttggc tccgcaagag caggcgttac agcaacagcg ccaatttgtg       420
     aaccagttgg cccatgagct caacacgcca ttggcgatcg tcaacggcag cctgcggcag       480
     ctgggcaaga agctgctgaa tttcggtgat ggatcacgcg agcgcttgcg ccaggcgcag       540
     caggaaacca gccggctggt gcgattgctg cgccatcttt tggtgctgac ggatctggaa       600
     acaggccgcc gccagctaca gctccagcct ttggccctca agccttggct gcaggagtgg       660
     atggcccagc aagttctgcc tgcttctgct gaattgaatc ttgtggctga tgttggcgag       720
     agcgctgtta ttgccgctga tgccgaggca ttggccgagg tgttggagca attgctcgat       780
     aacagcctgc gttacagcaa agggcctgct cagatcgagc tgcaactgct ggagctggat       840
     ggagcgagcg gtttgcgctg gcaagaccaa ggcctcggca tcacagctga accgcgcagc       900
     caggtgtttg agcgctttgt tcgattggag gaacatcgcg atttcaacca ggccgacgga       960
     gctggtctgg gactggcttt gtgtgaggcc ttgatgcaag ccatgggagg cagcactgga      1020
     ctagagccaa tcaccaacga atcgacgggc accgctttcc tattgagctg gcctcaggct      1080
     ggaggcaagt ag                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page