(data stored in ACNUC29543 zone)

EMBL: CT978603.PE566

CT978603.PE566       Location/Qualifiers
FT   CDS_pept        complement(500924..501292)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0566"
FT                   /locus_tag="SynRCC307_0566"
FT                   /product="Two-component system response regulator (signal
FT                   receiver domain)"
FT                   /note="Signal transduction mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27469"
FT                   /db_xref="GOA:A5GRG0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG0"
FT                   /protein_id="CAK27469.1"
FT                   /translation="MSSALVAIVDDDPRIQELLGAELTDLDQPHCSYCSADALLTDINN
FT                   SQPALIFLDVLMPGMGGMECLQHLRQQGFGGAVVMFSALNDAELQEQAKAAGANGWMLK
FT                   AALFDNVEAVLNRYLPPA"
     gtgtcctcag cgctggtggc catcgttgat gacgatcccc gcatccagga attgctgggg        60
     gcagagctca ctgatctcga ccaaccccat tgcagctact gcagtgctga tgccctactt       120
     accgacatca acaactccca accggcgttg atctttctcg atgtgttgat gcctggcatg       180
     ggcggaatgg aatgcctgca gcatctgcgc caacaaggct ttggcggtgc cgttgtgatg       240
     ttcagcgcac tgaacgacgc tgagctacag gagcaagcca aagcagctgg ggctaacgga       300
     tggatgctca aagcagcgct attcgacaac gttgaagccg ttttgaaccg ctacttgcct       360
     ccagcctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page