(data stored in ACNUC29543 zone)

EMBL: CT978603.PE567

CT978603.PE567       Location/Qualifiers
FT   CDS_pept        501418..502002
FT                   /transl_table=11
FT                   /gene="SynRCC307_0567"
FT                   /locus_tag="SynRCC307_0567"
FT                   /product="Uncharacterized conserved secreted protein, pili
FT                   subunit superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27470"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG1"
FT                   /protein_id="CAK27470.1"
FT                   /translation="MKRDAGFSLLELLLACSLGLLVFGVAASALLSEQKLGSRMGGLLR
FT                   QRQLLLRANQLIAADVQRGIALAPELVSPCHLAGRKRWLQLLNADGSITTYSIGKAPSG
FT                   IWQGEVLMRCGPAYGLDGRIKAGARSLNRVVLDGLVPSSQAWAGCSLPQAETFSEAPVC
FT                   WEPASGVVQWQLQRTSNRVTTQQDGQALLKG"
     atgaagcgag atgctggttt ctcacttttg gagttgctgc tggcctgcag ccttggattg        60
     ctggtgtttg gcgtcgctgc gtctgcgctt ctctcagagc aaaagcttgg tagccgcatg       120
     ggcgggctcc tccggcagcg acagcttctg ttgcgagcca atcaactgat tgcggctgat       180
     gtgcagcgcg gcattgctct ggctcctgaa ctggttagcc cttgccacct ggctggccgc       240
     aagcgttggc tgcagcttct caacgccgat ggctccatca ccacttacag cattggcaaa       300
     gctcccagtg gcatttggca aggggaggtt ttgatgcgct gcgggccggc ctatgggctt       360
     gatggccgta tcaaagctgg cgctcgatct ctaaaccgag tggtgctgga tggtctggtt       420
     ccgtcttcgc aggcatgggc tggttgttcg ttgccccagg cagagacctt ctcagaagca       480
     cctgtttgct gggagcccgc gagtggtgtg gtgcagtggc agctccagcg cacaagtaat       540
     cgagtgacca cacaacaaga tggacaagcg cttctcaagg gttga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page