(data stored in ACNUC29543 zone)

EMBL: CT978603.PE57

CT978603.PE57        Location/Qualifiers
FT   CDS_pept        53250..53759
FT                   /transl_table=11
FT                   /gene="SynRCC307_0057"
FT                   /locus_tag="SynRCC307_0057"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26960"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ01"
FT                   /protein_id="CAK26960.1"
FT                   /translation="MTEPAFLDFDLPPAAEVSPLDVEPIEPLEADRIEVQTFDPIKRAR
FT                   QLADTLPRQWQGTLRVAGSSERIPADLELDRLVPLEAMVDVFGQLTIAGQTVPVQGNLN
FT                   AATEQLNLLLLGDDLPADLEPGGNFLGLQMFNISMWVGPRLTSRAALLRLAPVAQYLEP
FT                   PVRGLW"
     atgactgagc cggcgttttt ggattttgat ctaccccctg cggcggaggt cagccccctg        60
     gatgtggagc caatcgagcc cctcgaggcc gaccgcatcg aggttcaaac ctttgatccc       120
     atcaagcgcg cccgccaact ggccgacacg ttgccgcgtc agtggcaagg caccctgcgg       180
     gtggctggct ccagtgagcg catccccgct gatctggagc tcgatcgcct ggtgccattg       240
     gaggcgatgg tggatgtgtt cggccaactg accattgcag gtcaaaccgt gccggtgcag       300
     ggcaacctca atgccgccac ggagcaattg aatctgctcc tgctcggtga tgatctgccg       360
     gctgatttgg agccgggtgg caatttcctt ggcctgcaga tgttcaacat cagcatgtgg       420
     gtggggcccc gtttgaccag ccgtgccgcc ttgctgcgct tggcaccggt tgcccagtac       480
     ctggaaccgc cagtgcgcgg actttggtga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page