(data stored in ACNUC29543 zone)

EMBL: CT978603.PE571

CT978603.PE571       Location/Qualifiers
FT   CDS_pept        507135..507407
FT                   /transl_table=11
FT                   /gene="SynRCC307_0571"
FT                   /locus_tag="SynRCC307_0571"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27474"
FT                   /db_xref="GOA:A5GRG5"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG5"
FT                   /protein_id="CAK27474.1"
FT                   /translation="MGVSLLLIGLTGLFWFLGMRNADEVIGILEKLMATLLLVLTLCVG
FT                   GGHVAISLLLLAVALSLPRARAFASTRFRSNSKITRESGELFLPF"
     atgggcgttt cgctacttct catcggactc acaggcttgt tctggttcct cggcatgcgc        60
     aatgccgatg aggtgatcgg catcctcgaa aagctgatgg ccaccttgct gttggtgctg       120
     acgctgtgcg ttggtggcgg ccatgtggcc atcagcttgc tgctgttggc ggtggccttg       180
     agcctgcccc gtgcccgcgc ctttgcctcc acgcgctttc gctccaacag caagatcacc       240
     cgcgagagcg gtgagttgtt tttgcctttt tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page