(data stored in ACNUC29543 zone)

EMBL: CT978603.PE573

CT978603.PE573       Location/Qualifiers
FT   CDS_pept        508110..508460
FT                   /transl_table=11
FT                   /gene="SynRCC307_0573"
FT                   /locus_tag="SynRCC307_0573"
FT                   /product="Predicted methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27476"
FT                   /db_xref="GOA:A5GRG7"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG7"
FT                   /protein_id="CAK27476.1"
FT                   /translation="MASQQSTSFDQRVYALVAQIPPGRLATYGQIAELLGCWGCARQVG
FT                   WALRRLQLPSEVPWQRVVNASGRISFSLAREGSDWIQRQLLIEEGIPVSEQGALPLRRY
FT                   LWTPELPIRIEP"
     gtggcgagcc aacaatccac cagttttgac cagcgggtgt atgccctggt ggcgcagatt        60
     cccccaggtc ggctggccac ctatggccaa atcgctgaat tgttgggctg ttggggctgc       120
     gcccgccagg tgggctgggc cctgcggcgg ctgcagctgc ccagtgaggt gccctggcag       180
     cgggtggtga acgccagcgg gcgcatcagc ttttcgctgg cccgggaagg cagcgattgg       240
     attcagcggc agctgttgat cgaggaaggc atccccgtca gtgagcaagg ggcgttgccc       300
     ttgcggcgct atctgtggac accggagctg cccattcgta ttgagccctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page