(data stored in ACNUC29543 zone)

EMBL: CT978603.PE58

CT978603.PE58        Location/Qualifiers
FT   CDS_pept        complement(53763..54281)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0058"
FT                   /locus_tag="SynRCC307_0058"
FT                   /product="Tetratricopeptide repeat domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26961"
FT                   /db_xref="GOA:A5GQ02"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ02"
FT                   /protein_id="CAK26961.1"
FT                   /translation="MDFALPQAYLLGLIVLLGVVAVVVGRQVLRVRKQEGQLASLESRC
FT                   QDSKADAASLYELGSVQLDKRLFAQAASSLKRAAKLSASEPAEARALIQNALGFALAAQ
FT                   QNHKDAVRHYRLALKARGDYPVALNNLAYSLEKQQKGDEAVELYQRSLELEPGNRTATK
FT                   RLKLLRPNG"
     atggacttcg ccctgcccca ggcctacctg ttgggcctga tcgtgttgct cggcgtggtc        60
     gctgtggtgg tgggccggca ggtcttgcgt gtcaggaagc aagaagggca actggcgagc       120
     ttggaaagtc gctgccaaga ctccaaggcc gatgccgcca gcctctacga gttgggatca       180
     gtgcaactcg ataagcgcct gttcgctcaa gcggccagca gcctcaaacg cgccgccaag       240
     ctctcggcta gcgaaccggc agaggccagg gccttgattc aaaacgccct tggctttgca       300
     ttggcagcgc agcagaacca caaggacgct gtgcgccact accggctggc gctcaaggcc       360
     cgtggggact atccggtggc gctcaacaac ctggcgtact cactggaaaa acagcaaaag       420
     ggcgatgaag ccgtggagct ctatcaacgc tccttggaac tggagcctgg taaccgcaca       480
     gccacgaaac gactcaagct gctgcgcccc aacggctaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page