(data stored in ACNUC29543 zone)

EMBL: CT978603.PE580

CT978603.PE580       Location/Qualifiers
FT   CDS_pept        514522..514761
FT                   /transl_table=11
FT                   /gene="SynRCC307_0580"
FT                   /locus_tag="SynRCC307_0580"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27483"
FT                   /db_xref="GOA:A5GRH4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH4"
FT                   /protein_id="CAK27483.1"
FT                   /translation="MGFNGLDLLPGLIGLLLVAVVITLVAWALNLMQSASDSNEFSLML
FT                   AGCLVCSAAVGLSTVMVISLTGPNAPLVHIFHAG"
     atggggttca acggattgga tctgttaccc ggattgattg gtttattgct cgtggccgtg        60
     gtgatcacct tggtggcctg ggccttgaat ctgatgcaat cagccagtga cagcaatgag       120
     ttttcgttga tgctggccgg ctgtttggtg tgttcggctg ccgtggggct ctctaccgtg       180
     atggtgatca gcctgacggg tcccaacgcg ccgttggttc atatctttca tgccggctga       240
//

If you have problems or comments...

PBIL Back to PBIL home page