(data stored in ACNUC29543 zone)

EMBL: CT978603.PE582

CT978603.PE582       Location/Qualifiers
FT   CDS_pept        complement(515447..516943)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0582"
FT                   /locus_tag="SynRCC307_0582"
FT                   /product="Carbohydrate-selective porin OprB related
FT                   protein"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27485"
FT                   /db_xref="GOA:A5GRH6"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRH6"
FT                   /protein_id="CAK27485.1"
FT                   /translation="MAVLAAQWTLNKLSHFAIAGIRPPLISESLGEAEPMALSSRFSLA
FT                   LLALSLSWLPAPVGAEPADQPKPAKQPKVMETPRGLLEAATFGEMLGLPDWMAMSLSLV
FT                   NQPMGNITGSKQRTFRSIDMQAIDWSLGSGLSKEDSDKDEFDRWSFRSSLATYIGVPPY
FT                   FSEDIGAAFPLQALEDTEGLQQGFWLQGLWLQRDSENLSLKFGNNLSLDPLVESPVYNA
FT                   YVNSTINSTLNLSLPGYPTVPFSSLGASLQWRANDRLTVNYGGYQLSNQRTGFPAGRWK
FT                   GWRFNLDRDDGLVQALRLDWALSETSGEPLLICMSQEHPDVVVRHHQGCKRPMRLENKL
FT                   PDPVLQLGAVSGSWRFPQINNPSRWENRANSIFASATLPVPFALGHGSRLWGSAVIGTE
FT                   PAINPVPLFLEGGWITQGVIRQRPFDSVVLGLTRSSFSPSLGRASGQRMTYEGMIELGY
FT                   ILQLSQELALQPGVQVIVNPEGTGDNETLVVPGLQVSFNW"
     atggctgttc tggctgccca gtggacgctc aacaagcttt cgcatttcgc catcgctggc        60
     atcaggccgc ccctaatttc tgaatcgctt ggggaggctg aaccgatggc gctgagcagt       120
     cgtttctctc tggcactgct ggccctatcg ctgtcgtggc tcccggcacc ggtgggtgct       180
     gaaccagctg atcaacccaa accagcgaaa cagcccaagg tgatggagac cccacgaggt       240
     ctcctcgagg cggccacctt tggcgagatg ctcggcctgc cggactggat ggccatgagc       300
     ctgagcttgg tgaaccagcc gatgggcaac atcaccggct ccaagcaacg aaccttccgt       360
     tcgatcgaca tgcaggccat tgattggagc ctgggcagcg gcctcagtaa agaggacagc       420
     gacaaagatg aattcgaccg ctggagcttt cgcagcagcc tggcgaccta catcggtgtc       480
     cccccgtact tcagcgagga cattggtgcg gccttccccc tccaagccct agaagacacc       540
     gaaggactgc agcaagggtt ttggctgcag ggcctttggc tgcagcgcga cagcgaaaac       600
     ttgagcctga aatttggcaa caacctcagc ctcgatccac tggtggaatc gccggtttac       660
     aacgcctacg tcaactcgac gatcaactcc acgctgaacc tcagcctgcc gggctaccca       720
     acggttccgt tcagctcact gggagccagc ctgcaatggc gagccaacga tcggctcacg       780
     gtgaactacg gcggctatca gctcagcaat caacgcactg gctttccagc cggccgctgg       840
     aaaggctggc gcttcaacct ggatcgcgat gacggccttg tgcaggcgct gcggctggat       900
     tgggccctga gcgagaccag cggcgaacct ctgctgatct gcatgagcca ggagcatccc       960
     gatgtggtgg tgcgccacca ccagggctgc aagcggccga tgcggctcga aaacaagctg      1020
     cccgatcccg tgctgcaact cggcgccgtt tcagggagtt ggcgtttccc gcaaatcaac      1080
     aaccccagcc gttgggagaa ccgcgccaac agcatctttg ccagtgccac cctgcctgtg      1140
     ccctttgccc taggccatgg cagccgcctc tggggcagtg ccgtcatcgg caccgagccc      1200
     gccatcaacc cagtgcccct gttcctagaa ggaggctgga tcactcaggg ggtgattcgg      1260
     cagcggcctt ttgactccgt ggttctgggc ttaacgcgca gcagcttttc cccctctctc      1320
     ggcagggctt caggccaacg catgacctac gaagggatga tcgagctggg ctacatcctg      1380
     caactcagcc aagagctggc gctgcaaccc ggcgttcaag tgatcgtcaa tcccgagggc      1440
     accggcgaca acgagacatt ggtcgtgccg ggcctgcaag tgagcttcaa ctggtag         1497
//

If you have problems or comments...

PBIL Back to PBIL home page