(data stored in ACNUC29543 zone)

EMBL: CT978603.PE586

CT978603.PE586       Location/Qualifiers
FT   CDS_pept        520246..522099
FT                   /transl_table=11
FT                   /gene="SynRCC307_0586"
FT                   /locus_tag="SynRCC307_0586"
FT                   /product="Predicted membrane metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27489"
FT                   /db_xref="GOA:A5GRI0"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI0"
FT                   /protein_id="CAK27489.1"
FT                   /translation="MARAWRAGLLLVPLALGWCWWRWPRPTPADPVHLAPQSVVLEGRI
FT                   QRPPRRVASGACSAVLQLEGAHQGRSQLWFRQCPKQLDPGWRLRVAGTLRQPKPPLHPV
FT                   LGDRAAQLARQGIFSTLAVQRYELLERQTQPLWQWRQQLAGRLQASAGPRHGALLSALV
FT                   MGRAMAPLPDAITNSFRAAGLSHALAASGFHLSVLLGVVLALTRRAPRLLRVISGAAAL
FT                   GLFVLLAGPMPSVLRAVLMGAIALLIRESGERARPLGLLLVSLLALLLWQPAWLLDLGF
FT                   QFSAVATAGLVLTAPRLQQQLPAALAVPIAACLWTLPLQLLHFGVLPLYAVPANLLAAP
FT                   LLTLLTTGAMAAALAAQLVPPLLPVITALLQWPAELLLLLVQGAAALPLAQLALGQPPL
FT                   VLVLLLSLGLMPWLLGCSGPWRRWGAGLVLISCLWQGQRLIADELLELPVGKGNLVLLR
FT                   HGGRGALVSRDAGPRSCSQAQRLRQALGLPRLDWVVLLDPVPADDFGCWQKLSSQLQVL
FT                   PCGELSSPGLVFRSQVQVPGEALLQLGRRCYCLRQQGVSANMGALAACGQCPTTKGGPP
FT                   KPASSAAARFSGAKNGRPCGTRCVTALSAAAARASVAAPRP"
     gtggcccgag cttggagggc tggcttgctt ctggtgccgc tggccttggg ctggtgctgg        60
     tggcgctggc ccaggccaac accggctgat ccggttcatc tggcgcctca atcggttgtg       120
     ttggaagggc gcatccagcg gccaccccgc cgtgtggctt ctggtgcctg cagcgcggtg       180
     ttgcagctcg agggggccca tcaagggcgc agccagctgt ggtttcgcca gtgccccaag       240
     cagcttgatc ccggttggcg tttgcgcgtg gctggcacgc tgcgccagcc caagccgccg       300
     ctgcatcccg tgctgggtga tcgagcggca cagctggcca ggcaaggcat tttcagcacg       360
     ctggccgtgc agcgctacga gctgctggag cgccaaacgc agccgttatg gcagtggcgg       420
     cagcaacttg ccgggcgctt gcaggcctct gccggccctc gccatggagc gctgttgtcg       480
     gcgctggtga tgggccgggc gatggcgcct ttgcctgatg cgatcaccaa ctcgtttcgc       540
     gccgctggcc tcagccatgc cttggccgcc agcgggtttc atctctcggt gctcttgggc       600
     gttgtgctgg ccctaacgcg gcgagccccg cgcctgcttc gagtgatcag cggggctgcg       660
     gcattggggc tgtttgtgct gttggcaggg ccgatgccat cggtgctcag ggcggtgttg       720
     atgggggcca tagcgctatt gattcgtgaa tccggtgaac gggcacggcc tttggggctg       780
     ctgctggtga gcttgctggc tctgctgttg tggcagcccg cttggctgtt ggatctcggc       840
     tttcagttca gtgccgtggc caccgctggc ttggtgctca ccgcccctcg gctgcagcag       900
     cagctgccgg ctgccctggc ggttccgatc gccgcatgcc tgtggacatt gccgctgcag       960
     ctcctgcatt tcggcgtgct gccgctctac gccgtgccgg ccaatctgct ggcggcacca      1020
     ctgctcaccc tgctcaccac cggcgccatg gcggcggctc tggcggcgca actcgtgccc      1080
     ccgctgctgc cagtgatcac tgctttgttg cagtggcctg ccgaactgtt gctgctgctg      1140
     gtgcagggcg cggcggctct gcctttggcc cagctggcct tgggccaacc gccgctggtg      1200
     ctggtcctgc tgttgagctt ggggttaatg ccttggcttt tgggatgcag tgggccctgg      1260
     cgacgctggg gcgcagggct ggtgctgatc agttgcctct ggcaagggca gcgtttgata      1320
     gctgatgagc ttcttgagtt gccggttggg aagggcaacc tggtgctctt gcgccatggc      1380
     ggccgcggcg ccttggtgag ccgcgatgca gggccccgca gttgcagcca agcccaacgt      1440
     ttgcgccagg ccctgggctt accgcggctg gattgggtgg tcctcttgga tccagttcca      1500
     gctgatgatt tcggctgctg gcagaagttg agctcgcagc tgcaggtgct gccgtgtggt      1560
     gagctcagca gccctggctt ggtgtttcgc agtcaggtcc aggtccctgg tgaggcgctg      1620
     ctgcagctgg ggcgccgctg ctattgcctc cgccaacagg gcgtgagcgc caacatgggc      1680
     gcccttgcgg cctgcggtca gtgccccacc acgaagggag gcccaccaaa acctgcgtcc      1740
     agtgcggccg cccgtttcag tggcgcaaaa aatggaaggc cgtgtgggac gaggtgcgtt      1800
     actgctctga gcgctgccgc cgcgagagca agcgtcgcag cccctaggcc ctaa            1854
//

If you have problems or comments...

PBIL Back to PBIL home page