(data stored in ACNUC29543 zone)

EMBL: CT978603.PE588

CT978603.PE588       Location/Qualifiers
FT   CDS_pept        523728..524624
FT                   /transl_table=11
FT                   /gene="SynRCC307_0588"
FT                   /locus_tag="SynRCC307_0588"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27491"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI2"
FT                   /protein_id="CAK27491.1"
FT                   /translation="MPYSPNPRSQAAFFRRSFKALLACASAAALSVTAAKAQEDELNVV
FT                   CPPTDTRPNLGVVATSEAYCAGTPEKYQLIIYEMGLCTSNPTSSNVLDQSSCTPTFRSE
FT                   GGTTVNLAGGAVIDLGSSEESDLGRPEDNSYSYAYIIISNRFVLRAKWGNTDGITYYSN
FT                   PGGLNNVSLSPPALDFVEDLSSFDEGFDPVYPPIIVRGGTLAALLLKSDLTPASNGLEV
FT                   GRLVGTFKPQASLVIDEAVKGLKVELTVSNSGLTVGVGENPGDFNGPPSDPRAFNCYQQ
FT                   PCSYGSGPFQPTFTLIK"
     atgccttatt ctcccaaccc cagatcccaa gcagccttct ttaggagatc tttcaaggcc        60
     cttttggctt gtgcttctgc cgctgcgttg tctgtcacag ctgctaaggc acaagaagac       120
     gaattaaatg ttgtatgtcc tcccacagat acaaggccaa atttaggcgt agtggccacg       180
     tctgaagcgt attgtgctgg aacgcctgaa aagtatcaac tcattattta tgagatgggt       240
     ctatgcactt ctaatccaac ttcttctaac gtattggatc agtcttcctg tacgccaaca       300
     tttagatctg aaggtggtac tactgtgaac ttggctggtg gtgcggtcat tgatcttggg       360
     tcaagcgaag aatctgatct ggggaggcct gaggacaact cttattcata cgcctacatt       420
     attatttcta atagatttgt cttgagggct aagtggggga atacagatgg aattacttat       480
     tattcaaatc ctggcggatt gaataatgtc agtttatctc ctcccgctct tgactttgtt       540
     gaggatctgt caagctttga tgaagggttt gatccggttt acccgcctat tattgttaga       600
     ggcggtacat tggctgcttt gctattgaaa tctgatttaa ctccagcatc caatggatta       660
     gaggttggaa gactggtggg aacttttaag cctcaagcca gcttagtgat tgatgaagca       720
     gttaaaggtc tgaaggtcga gctcactgtt tcgaatagcg gtttgaccgt tggagtcggc       780
     gaaaatcctg gcgactttaa tggtcctcca agtgatcctc gtgcttttaa ttgctatcag       840
     cagccttgta gttatgggtc aggtcctttt cagccaacat tcaccttgat taagtaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page