(data stored in ACNUC29543 zone)

EMBL: CT978603.PE589

CT978603.PE589       Location/Qualifiers
FT   CDS_pept        complement(524722..525171)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0589"
FT                   /locus_tag="SynRCC307_0589"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27492"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRI3"
FT                   /protein_id="CAK27492.1"
FT                   /translation="MLLLASLSGLLLASGNCEFLQPIGGDGNTTVTKRVDRPKVSPLRM
FT                   ALGRTNWNTDFSVNQPYRSYKLFFTAQSTEQATYPIEAYLKFSDGSNLRVVDESMKPPV
FT                   GTGSMFGPFTVPSGKAVSQVNFKIGASKDPGASGFSYRISVQGCH"
     atgctcctac tagccagcct gagcgggctg ctattggcct ccggtaactg cgagttcctc        60
     caaccgatcg gcggtgacgg caacaccacc gtgaccaagc gggtggatcg accgaaggtt       120
     tctcctttgc ggatggcgtt aggccgcacg aactggaaca cggatttcag cgtcaaccag       180
     ccctaccgca gttacaagct gttcttcaca gcgcaatcca ccgaacaggc cacctatccg       240
     atcgaggctt acctcaaatt cagcgatggt tcgaacctgc gcgtggtcga tgaatcaatg       300
     aagccaccgg tggggaccgg cagcatgttt gggcctttca cagtcccaag cggcaaggct       360
     gtgagccaag tgaatttcaa aattggcgcc agcaaagacc ccggagcctc cggcttcagc       420
     taccgaatat ctgtacaagg ctgtcactaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page