(data stored in ACNUC29543 zone)

EMBL: CT978603.PE597

CT978603.PE597       Location/Qualifiers
FT   CDS_pept        complement(530805..531932)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0597"
FT                   /locus_tag="SynRCC307_0597"
FT                   /product="Integral membrane protein (PIN domain
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27500"
FT                   /db_xref="GOA:A5GRJ1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRJ1"
FT                   /protein_id="CAK27500.1"
FT                   /translation="MAISLANSRRSRSPRPSSLIVEALLLLLFVISGAAAGFLGVDLLP
FT                   PRMLIQVTNLEGLQWVMGGFGAFFGLIAGFLFQRLRAQLMRQVRTMPTDLLISRAVGLI
FT                   LGLLVANLLLAPILLLPLPWEVGFVKPLAAVLSNVFFGVSGYNLAEVHGRTLLRLFNPS
FT                   STEALLVADGVLQPASPKIVDTSLIIDGRLRGLLESEILEGQVIVAQCVIDELQQLADS
FT                   GNSDKRSKGRRGLKLLAELRDSYGRRLIVNSTRYEGDGVDDKLLKLCSDTGGLLLTTDY
FT                   NLAKVAQVQNLRALNLSELVISLRPEVQPGDLLQLKIVREGKEADQGVGYLEDGTMVVV
FT                   ESGRGSIGERREVTVTGALQTPAGRMVFARTADAR"
     atggcaatct ccctggcaaa ttcgcgcaga tcgcgctcgc cgcgtccctc cagtctgatt        60
     gtggaagctc tgctcctgct gttgtttgtg atctccgggg ctgccgctgg cttcctcggg       120
     gtggatctgc tgccgccgcg catgttgatc caggtcacca acctggaagg cttgcagtgg       180
     gtgatggggg gctttggcgc cttctttggc ctgattgccg gcttcctgtt ccaacggctg       240
     cgagcccagc tgatgcgcca ggtgcgcacc atgcccaccg acctgctgat cagccgggcg       300
     gtggggctga tcttgggact gctggtggcc aatctgctgc tggcaccaat tctgctgctg       360
     ccgttgccat gggaagtggg ctttgtgaag cccctggccg ccgtgctcag caacgtcttt       420
     ttcggcgtca gcggttacaa cctcgccgaa gtgcatggcc gcaccctgct gcggctgttc       480
     aaccccagca gcaccgaagc gctgcttgtg gctgatgggg tgctgcagcc cgccagccca       540
     aaaattgtgg acaccagctt gatcattgat ggccgcctta ggggcctgct ggaaagcgaa       600
     atcctggagg ggcaggtgat cgtggcccag tgcgtgatcg atgagctgca gcagctggct       660
     gattcgggca acagcgacaa acgcagcaag ggccgccgcg gcctcaagct gctggctgag       720
     ctgcgcgaca gctacggccg ccggctgatc gtcaacagca cccgctacga aggcgatggc       780
     gttgacgaca agctcctgaa gctctgcagt gacaccggcg gcctgctgct caccactgac       840
     tacaacctgg ccaaggtggc tcaggtgcaa aacctgcggg cgctcaacct cagcgagctg       900
     gtgatcagcc tgcggcctga ggtgcaaccg ggcgacctgc tgcagctcaa aatcgtgcgc       960
     gagggcaaag aagccgacca gggcgtgggt tacctggaag acggaacgat ggtggtggtc      1020
     gaatctggca gaggcagcat tggcgagcgg cgcgaagtga cggtgaccgg cgccttgcag      1080
     acaccggcag gccgaatggt tttcgcccga acggcagatg ctcgctag                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page