(data stored in ACNUC29543 zone)

EMBL: CT978603.PE6

CT978603.PE6         Location/Qualifiers
FT   CDS_pept        complement(8482..9366)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0006"
FT                   /locus_tag="SynRCC307_0006"
FT                   /product="Secreted Tetratricopeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26909"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV0"
FT                   /protein_id="CAK26909.1"
FT                   /translation="MRRWLPALCAAALLSPVLPARALVPYVYVPTSEELNDAGVNIAGA
FT                   AAGLLRIGQIAEARRLGRLAVQLLPDDPRAWLVLAEAELRSSDGNNRGEQTAKAEAALA
FT                   RAKELDPKNAGVWFAEGSLNLRNDRPAAAEQLLKEGLRLDPKNPGAYFDLGNAQIKQGN
FT                   LGAALKSFEKASGLRQNFWEAVNNQGIVLFEEDRRDDAINRWRQAVEMSDGEAEPMLAL
FT                   AAALYANGDDSADTLGLAVQALIKQPDYVLAAFQEDQLWGTKLVAATQELFENEQVKGA
FT                   VQRAKGLATFQSN"
     atgcgtcgtt ggctgcccgc tctctgcgcc gcggcgttgc tctcccccgt gctgccagca        60
     cgggccctgg ttccctacgt ctatgtgccc acgagcgaag agctcaacga tgcgggggtc       120
     aacattgctg gagccgcggc cgggctgttg aggatcggcc agatcgcgga agcccggcgc       180
     ttgggccgtt tggctgtgca actgcttcca gatgatccaa gggcttggct ggtcttagcg       240
     gaagccgaac tgcgcagctc cgatgggaac aaccgcggcg aacagacggc caaagcagaa       300
     gcagccctgg ctcgcgccaa agaactcgac cccaaaaacg cgggggtttg gtttgccgaa       360
     ggttccctaa acctgcgcaa cgaccggcca gccgctgccg aacaactgct gaaagaaggt       420
     ctgcgcttag accctaaaaa ccctggcgca tatttcgatc taggcaacgc ccagatcaag       480
     cagggcaact tgggcgcggc cttgaaatcc tttgaaaaag catcgggact gcgtcaaaac       540
     ttttgggaag ccgtcaacaa ccaaggcatc gttttatttg aagaggaccg gcgtgacgat       600
     gccatcaatc gctggcgcca agcggtggaa atgagcgacg gcgaagccga gccaatgctg       660
     gccctcgccg cggctctcta tgccaacggc gatgactcag ccgacacgct gggtctagcg       720
     gttcaagccc tgatcaagca gcccgattac gttctggccg cctttcaaga ggatcagctg       780
     tgggggacaa aactcgttgc agccacccaa gagctctttg aaaacgagca agtcaaaggt       840
     gctgtgcagc gtgccaaggg gttggcgacc ttccaaagca actag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page