(data stored in ACNUC29543 zone)

EMBL: CT978603.PE609

CT978603.PE609       Location/Qualifiers
FT   CDS_pept        complement(542953..543423)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0609"
FT                   /locus_tag="SynRCC307_0609"
FT                   /product="Secreted pentapeptide repeats protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27512"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRK3"
FT                   /protein_id="CAK27512.1"
FT                   /translation="MLRLLVVLLLNLSLLWPLQPAMASGSYLEKTDYTLTNQSDADFSG
FT                   QDLEGSSFAGAVVRNADFSGAKLHGAIFTQGAFAGSNFAGADLSDVLMDRADFTGTNLS
FT                   GTNLSGVVANGSSFAKAEIEGADFTGALLDRDDQITLCRKAKGETRLSLDCP"
     atgctgcgcc tgcttgttgt gctgctgttg aacctcagcc tgctgtggcc cctgcaaccg        60
     gccatggcca gcggcagcta tctggaaaaa accgactaca ccctcaccaa ccaaagcgac       120
     gctgatttca gcggccaaga tctcgagggc agctcctttg ccggtgccgt ggtccgcaat       180
     gctgatttca gcggcgccaa gctgcacggg gcgatcttca cccaaggggc ttttgcgggc       240
     tccaacttcg ccggcgccga tctcagcgat gtactgatgg accgcgctga tttcaccggc       300
     accaacctca gcggcaccaa cctcagtggc gtggtggcca atggcagcag ctttgccaaa       360
     gccgagatcg agggtgctga tttcaccggc gccctgctcg atcgcgatga tcaaatcacc       420
     ctctgccgca aagccaaagg ggaaacgcgc ctaagcctcg actgcccctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page