(data stored in ACNUC29543 zone)

EMBL: CT978603.PE619

CT978603.PE619       Location/Qualifiers
FT   CDS_pept        complement(553491..557129)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0619"
FT                   /locus_tag="SynRCC307_0619"
FT                   /product="Putative outer membrane protein, contains Hep_Hag
FT                   repeats"
FT                   /note="Possible HGT"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27522"
FT                   /db_xref="GOA:A5GRL3"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL3"
FT                   /protein_id="CAK27522.1"
FT                   /translation="MRAPLKLALGTGAFVLIGSSPALAQIGLCTVNPASDLIFAGAGSP
FT                   LIFSGAGATPFTVEGGGSPLVITGNGGAAVEVGGTFTAACEGIYCEGIGDVTIDGAGGF
FT                   EIGGASEYTIMGEGLSSFTMDGEYTFTSEGAFSATACGSEANTGSFASGLGSTANGVEA
FT                   VALGIAAAAGGAQNVVVGTTAGGDGDQITVLGNNITADGDQAIAIGNEAAAGGALSIAI
FT                   GNEAEAGTTAGVAIGANVGGNGLAITVLGANATADGDQGVAVGQGAGAAGAQTVAIGNG
FT                   AQAGGAGTISIGNGVSANGDAIVALGTGVQVTASDTIAIGNGVTSNASQSNVLIGSGIA
FT                   SVATYDNVVIGKDIGSLGAAGNIVIGSGDGDLGTAASIMLGNGVAAAGMSGNILMGNDA
FT                   TAEFSVGSVAIGNSVNIGGNAGGVVIGNGATADGGVNQVVIGNGVVSVANSTVVIGDSA
FT                   MTSDDADGAIAIGSQTRATAVDALAMVSATASGESSIAIGSTAEATQYGSIAFGGDASS
FT                   TKLGAIAIGANTSVSGETGIALGYQSSVSGTNAIAIGANTSATCANSFVLGAGAIANGT
FT                   GAGAIGYLANTQGSDAMAIGVQACALGDNSMALGTSAISKGIDSVAIGYSACSSATNSS
FT                   AIGTNATANGTNSMAFGANSLASGINATAIGANAWADQTNSIVIGPNARACGVNAGAIG
FT                   ASANANGESSLAIGVKSFAKETSSLALGTNASSIGTNSTAIAVNASSTGANSMAIGYFS
FT                   TSNGVNSSALAVKANASGDNSVALGVFANAQGGNSLAFGTCSIASGTNATAISSDASAT
FT                   GNNSIAIGVDSIASQENAQSFGVKARAEGINAVAIAAGSFANGENSMAIGVLANATALN
FT                   TAAIGTFARASQNGALAFGSNASATANYAMALGVNALANSNGAIAIGRYANAVSTETFA
FT                   AGALHKPSTTTPWPLAAMPKQPAPTPWRLAPEATPSTTTPLQLVLRQKRSDTTPWRLVF
FT                   SPKRCKPTAWPTEPEPMPVPSMPWLPAQTHKHLVSHQSPPAPKRKPAKPGLLPSGPAAV
FT                   QQGFKPLPWVVRQKRPAHMPSQLASTVWPIKLARLQLARKPKPPPMGPWHWLLSPMPAA
FT                   QTPSPPVTTHLLQAITPSPLALVPVPQLEMLSPQACKPMRAVPPLLPSAPTPSLAVSIP
FT                   LPSAPHHKPLISMPIPLAWKASPVLKMRPLLAPWPKPQELTHLRLD"
     gtgcgtgccc ccctcaagtt agctcttggc actggggctt tcgttcttat cggatcctct        60
     cctgcgctag cgcagatagg tctttgtact gttaatcctg catcagatct gatttttgca       120
     ggtgctggtt ctccgctcat attctcaggt gcaggtgcta caccatttac agttgaaggc       180
     gggggttctc ctctcgttat tacaggcaac ggtggggctg cggttgaggt aggcggaaca       240
     tttacagccg catgtgaagg tatctactgt gaaggcatcg gagacgtcac gattgatggc       300
     gcaggcggat ttgaaattgg aggggcaagt gagtacacaa tcatgggtga aggcttatct       360
     tcattcacca tggatggtga atacacattc accagcgaag gtgcattttc tgccactgct       420
     tgcgggtctg aagcaaatac tggttctttc gcctctggtc ttggctctac tgcaaacgga       480
     gttgaagctg tagctctcgg cattgcagct gcagccggag gagcacaaaa cgttgtcgtc       540
     ggaacgacag caggtggaga cggagatcag ataacagttt tgggcaacaa catcaccgct       600
     gatggtgatc aagccattgc cattggaaat gaagctgcgg caggtggagc gctctcgatt       660
     gccattggca atgaggccga ggcaggaact actgctggag ttgcgatcgg cgccaatgtt       720
     ggtggtaacg gtttagcaat cacagttctc ggagccaatg ccactgctga tggcgaccaa       780
     ggtgttgccg ttggacaagg tgctggtgct gcaggagctc aaacggttgc cattggcaat       840
     ggagctcaag caggtggagc tggcacaatt tccataggca acggcgtttc ggccaatggt       900
     gacgcgatcg ttgctcttgg aacgggagtt caagttacgg cctctgacac cattgcgatt       960
     ggcaatggtg tcacatcaaa tgcaagccaa tccaatgttt tgattggtag cggcattgcc      1020
     tctgttgcca cctacgacaa tgttgtaatc ggaaaagata ttggaagttt aggcgcagca      1080
     ggaaacattg ttatcggctc tggcgatgga gaccttggaa ctgctgccag catcatgctt      1140
     ggcaatggcg ttgcagccgc tggtatgtct ggaaatattt tgatgggtaa tgacgccacg      1200
     gctgagttct cagtgggttc agttgcgatc ggcaactcag tcaacatcgg aggcaatgcg      1260
     gggggcgttg tcatcggcaa tggagcaaca gctgatggag gagtcaatca agtcgtaatt      1320
     ggcaatgggg ttgtttcagt agccaactca acagttgtca ttggtgattc agctatgact      1380
     tcagacgatg cagatggtgc aatcgcgatt ggttctcaaa ctcgagccac ggctgttgat      1440
     gctcttgcaa tggtcagtgc cacagcttct ggtgaatctt ccattgcaat tggcagtact      1500
     gctgaagcca ctcaatatgg ctcaattgcg tttggcggag atgcttcttc tacaaaactt      1560
     ggagccattg ccattggcgc caataccagc gtatctggtg agactggtat tgcgcttggc      1620
     taccaaagca gtgtttctgg aaccaacgct attgcaatcg gcgccaacac ctctgcaacc      1680
     tgcgccaact cctttgttct tggggcaggc gctatagcca atggcactgg tgcgggtgct      1740
     attggctatt tggctaacac tcaaggcagc gatgcaatgg ccatcggtgt tcaagcctgc      1800
     gccttggggg acaactccat ggctctgggc acatcagcca tctcgaaagg aattgattcc      1860
     gtcgccattg gctatagcgc ttgctcatcg gcaaccaact cctctgcgat tggcacgaat      1920
     gccactgcca atggcaccaa ctccatggcc tttggtgcca actcacttgc ctcagggatt      1980
     aacgcaacag caatcggtgc taacgcctgg gcggatcaaa ccaattccat cgtgatcggc      2040
     cctaacgctc gcgcttgcgg ggtgaatgct ggtgcaatcg gagctagtgc caatgctaat      2100
     ggtgagtctt ccttagccat tggtgttaag tcttttgcca aagaaacaag ttccctagca      2160
     ctcggcacca atgcttcttc cattggaacc aactcaacag caattgccgt taatgcctcc      2220
     tccactggtg ccaattccat ggccattggc tatttctcca catccaatgg tgtgaattca      2280
     tcagcattgg cggtgaaagc caatgccagt ggtgacaact ctgttgcttt gggcgtcttt      2340
     gccaatgcac aaggcggtaa ttcacttgcc tttggcacct gctccatcgc atcaggcacc      2400
     aacgcaaccg ccatcagctc ggatgctagc gccacaggca ataactccat cgccattggt      2460
     gttgactcca tcgccagcca agaaaatgcc cagtcctttg gtgttaaggc cagagcagaa      2520
     ggtatcaatg ctgtggccat tgccgctggt tctttcgcca atggtgagaa ttccatggcc      2580
     attggcgttc ttgccaatgc cacggcctta aacaccgccg caatcggcac ctttgcccgt      2640
     gctagccaga atggcgctct cgcctttggc tccaacgcat cggcaacagc caactacgcc      2700
     atggccctgg gtgtgaatgc ccttgccaac agcaatggag ctattgccat cggccgctac      2760
     gccaatgcag tgagcactga aacatttgca gctggcgcct tgcacaagcc ctcaacgaca      2820
     acgccctggc cattggcagc aatgccaaag caaccggctc caacaccatg gcgattggca      2880
     ccagaagcaa cgccttctac gacgacgcct ttgcagctgg tcttgaggca gaagcgatcg      2940
     gatacaactc catggcgctt ggttttcagt ccaaagcgct gcaaaccaac agcctggcct      3000
     acggaaccag agccaatgcc agtgccatca atgccatggc taccggcaca gactcacaag      3060
     catctggtgt ctcatcaatc gcctccggca cccaagcgca agccagcaaa accggggcta      3120
     ttgccatcgg gcccagcagc cgtgcaacag ggattcaaac cattgccatg ggtggtgagg      3180
     cagaagcgac cggcgcatat gccatctcaa ttggcttcaa cagtttggcc aatcaaactc      3240
     gctcgtttgc agctggcgcg caagccaaag ccaccgccaa tggggccatg gcactggctg      3300
     ctttctccaa tgccagcggc acagactcca tctccgccgg ttacaactca cttgctacag      3360
     gcaataacgc catctccttt ggcactggta cccgtgccac agctcgagat gctttcgcca      3420
     caggcttgca agccaatgcg agccgtgcct ccgcttttgc catcggcacc aacaccatcg      3480
     ctagcggtat caattccatt gccctcggca cctcatcaca agccactaat ctcgatgcct      3540
     attcctttgg cgtggaaagc atcgccagtg ctgaaaatgc gaccgctatt ggcaccatgg      3600
     ccaaagccac aggagctaac tcatttgcgg ttggattag                             3639
//

If you have problems or comments...

PBIL Back to PBIL home page