(data stored in ACNUC29543 zone)

EMBL: CT978603.PE620

CT978603.PE620       Location/Qualifiers
FT   CDS_pept        complement(557273..557566)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0620"
FT                   /locus_tag="SynRCC307_0620"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27523"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL4"
FT                   /protein_id="CAK27523.1"
FT                   /translation="MPKDSSPKDPKKKAQNSAFGIAVNSDSSHLLAQAASSLPETVTIS
FT                   GTEYKTEELSNQTKQLVLIYLADQKILGQQKELLALAELGLKTLVKEIESSI"
     atgccaaagg attcatcccc aaaagatccc aagaaaaaag ctcaaaactc agcctttggg        60
     atcgctgtta attctgattc aagccatctc ttggctcaag ctgcgagttc gctgccagaa       120
     acggtcacga ttagcggaac agaatacaaa accgaggaac tcagcaatca aaccaaacaa       180
     ctggtgttga tttacctggc cgaccagaag attcttgggc aacaaaaaga actgctagca       240
     ctcgccgagc ttggactcaa aacgctcgtc aaggaaatcg agtcgagcat ctag             294
//

If you have problems or comments...

PBIL Back to PBIL home page