(data stored in ACNUC29543 zone)

EMBL: CT978603.PE622

CT978603.PE622       Location/Qualifiers
FT   CDS_pept        558675..558956
FT                   /transl_table=11
FT                   /gene="SynRCC307_0622"
FT                   /locus_tag="SynRCC307_0622"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27525"
FT                   /db_xref="GOA:A5GRL6"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL6"
FT                   /protein_id="CAK27525.1"
FT                   /translation="MCECKPEQSNNLPAQGEPAAVGPLAAVLLLLLAIYRRLISPLLGP
FT                   RCRYVPTCSSYAVEAVQRHGALRGSWLTLKRLLRCHPFAEGGYDPVPE"
     gtgtgcgagt gcaagcctga acaatccaac aatttacctg cccaagggga gcctgccgct        60
     gttggccctt tggctgcagt tctgctgttg ctgctggcca tctaccgccg cttgatttca       120
     ccgctcttgg gtccgcgctg ccgctatgtg cccacctgca gcagctatgc cgtggaggcg       180
     gtccagcgcc atggggccct gcgcggcagc tggctcacct tgaagcggtt gttgcgctgc       240
     catccctttg ccgaaggcgg ctatgacccg gtgccggagt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page