(data stored in ACNUC29543 zone)

EMBL: CT978603.PE623

CT978603.PE623       Location/Qualifiers
FT   CDS_pept        558953..559240
FT                   /transl_table=11
FT                   /gene="SynRCC307_0623"
FT                   /locus_tag="SynRCC307_0623"
FT                   /product="Thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27526"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRL7"
FT                   /protein_id="CAK27526.1"
FT                   /translation="MMAMADLSWPALTLITRQGCCLCEGLQERLEALDPAPPLQCVDVD
FT                   GDAQLQARFGLEVPVLMTASGEVLARVPPRLSGDRLADWLQRSLNSSNSA"
     gtgatggcga tggctgatct gagctggcca gcgctgacat tgatcacccg ccaaggctgc        60
     tgcttgtgtg agggtctgca agagcggctt gaggcgttgg atcccgcccc accgctgcag       120
     tgcgtggatg tggatggcga tgcgcagttg caggcgcggt ttggtttgga ggtgcctgtg       180
     ctgatgaccg cctctggtga ggtgttggcg cgggtgccgc cccgcctgag tggtgaccga       240
     ctcgctgatt ggttgcagag gagcctcaac agcagcaatt ccgcctaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page