(data stored in ACNUC29543 zone)

EMBL: CT978603.PE633

CT978603.PE633       Location/Qualifiers
FT   CDS_pept        574526..575404
FT                   /transl_table=11
FT                   /gene="SynRCC307_0633"
FT                   /locus_tag="SynRCC307_0633"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27536"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRM7"
FT                   /protein_id="CAK27536.1"
FT                   /translation="MRGRSEPERQQWARWVLGSHSDLFLPEMAAAVDQLNRHDPIEQGQ
FT                   PVVNPGATPNDLVVIATQRGRHCVVFDQPLACPVVLFDWTGDGLEPGSNPHGFDVISVA
FT                   TECKGHLMEESWKRLPPPAGGHYMGFIDDDVLISASAINRLLAVARIHNLSAAQPAVSF
FT                   GSSLCQEYGWLRQRACTTLHRVPIVEIMAPFIRRDLLELAMPFLKGVRSGYGLDRFALP
FT                   LCAVHLNAWRFGAVDLTPLTHVRVFGSLEKRFSNGLLSKEEEHLIRQRLMQSMGFAVDQ
FT                   ALHQQLEAAVA"
     atgcggggac gttccgagcc agagcggcag cagtgggccc gctgggtttt ggggagccac        60
     agcgatctgt tccttccgga gatggctgcc gctgtggacc agctcaaccg gcatgacccc       120
     attgagcagg gccagcctgt ggtgaatcca ggggcaacac caaatgatct ggtggtgatt       180
     gccacccagc gcggccgcca ttgcgtggtg tttgatcagc cccttgcgtg cccagtcgtt       240
     ttgtttgatt ggaccgggga tggccttgag cccggcagta atccccacgg ctttgatgtg       300
     atcagcgtgg cgaccgagtg caaaggccat ctgatggaag agtcctggaa gcgtcttccg       360
     ccgccagcag ggggccacta catgggtttt atcgatgacg atgttttgat cagtgccagc       420
     gcgatcaatc ggctactggc cgtggcacgg atccacaacc tcagtgcagc gcagcctgcg       480
     gtcagttttg gcagcagtct ctgtcaggaa tatggctggt tacggcaacg ggcctgcacg       540
     acgctgcacc gggtgccgat tgtggaaatc atggctccat tcattcgccg tgatctgctc       600
     gaactggcga tgcctttttt aaaaggagtg cgcagcggct acggcctcga tcggtttgcc       660
     ctgccgctct gcgctgtcca tctcaatgcc tggcgctttg gcgctgttga tctcacgcca       720
     ctgacccatg tgcgggtgtt tggttcgctt gagaaacgct tctccaatgg tttgctcagc       780
     aaggaagagg aacatctgat tcggcaacgc ctcatgcaat ccatgggctt tgccgtggat       840
     caagccctgc atcaacaact tgaggcggct gttgcttga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page