(data stored in ACNUC29543 zone)

EMBL: CT978603.PE636

CT978603.PE636       Location/Qualifiers
FT   CDS_pept        complement(577184..577687)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0636"
FT                   /locus_tag="SynRCC307_0636"
FT                   /product="Predicted metal-binding, possibly nucleic
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27539"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN0"
FT                   /protein_id="CAK27539.1"
FT                   /translation="MRPVALQELKQLGDGKHWNVEQQLSELDSIGPVKGWLKALHRGDD
FT                   LWLEAEATATVELICDRCLKSYPQPLEARVSESIALQSGGPDAELEELDGAEAALETLD
FT                   PHGRFDPEHWLFEQLNLQLPLKRLCSPDCPGLLPEQESSPATSTDVVDPRWAQLQQLKG
FT                   EEQP"
     atgcgtccag tggccctgca ggagctcaag cagctcggcg atggcaaaca ctggaacgtg        60
     gagcaacagc tgagcgagct ggacagcatc gggcccgtca aaggctggct caaggccttg       120
     caccggggtg atgacctctg gctggaagcg gaggccacag ccaccgtgga gctgatctgc       180
     gatcgctgcc tcaagagcta cccgcaaccg ctagaggcgc gggtgagcga atcgattgcg       240
     ctgcaaagcg gagggcccga tgccgagctt gaggagctcg atggggctga ggcagcgctg       300
     gaaaccctcg atccccatgg ccgctttgat ccggagcact ggctctttga acaactgaat       360
     ctgcagttgc cgctcaagcg gctgtgcagc cccgactgcc ccgggctatt gccagagcag       420
     gagagcagcc cggcgaccag cactgatgtg gtagatcccc gctgggccca gctgcagcag       480
     ctcaaaggcg aggagcagcc atga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page