(data stored in ACNUC29543 zone)

EMBL: CT978603.PE638

CT978603.PE638       Location/Qualifiers
FT   CDS_pept        complement(578863..579291)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0638"
FT                   /locus_tag="SynRCC307_0638"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27541"
FT                   /db_xref="GOA:A5GRN2"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN2"
FT                   /protein_id="CAK27541.1"
FT                   /translation="MSVVTPPAIKEEIHYEGGPARGDLIINLIFGVTLIGLPFAIGAVV
FT                   RALWLRFKVTSRRVSVTGGWLGRDRSQVTYTQIKEVRSVARGFGAYGDMVLVLKDGARL
FT                   EMRAVPRFREMQTYIEERIASKGKPADAPSGFTASSAS"
     atgagtgttg tcaccccacc tgccatcaaa gaggagattc actacgaagg cgggcctgcg        60
     cgcggtgatc tgatcatcaa cctgatcttt ggcgtcacct tgattggtct gccctttgcc       120
     attggtgcgg tcgtccgcgc cctgtggctg cgcttcaagg tgaccagtcg ccgggtgtcc       180
     gtcaccggtg gctggctggg ccgtgaccgc agccaggtga cctacaccca gatcaaagag       240
     gtgcgctcgg tggcccgcgg ctttggcgcc tacggcgaca tggtgctggt cctcaaggac       300
     ggtgcccggt tggaaatgcg cgctgtgccc cgtttccgtg agatgcagac ctacatcgag       360
     gagcgcatcg ccagcaaagg gaagccggcc gatgctccct ctggcttcac agccagcagc       420
     gccagctaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page