(data stored in ACNUC29543 zone)

EMBL: CT978603.PE642

CT978603.PE642       Location/Qualifiers
FT   CDS_pept        complement(580544..581185)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0642"
FT                   /locus_tag="SynRCC307_0642"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27545"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN6"
FT                   /protein_id="CAK27545.1"
FT                   /translation="MTTGEGAEPHENQPTDVGHLMALRLRTVLGLGGAAALAGGIALSG
FT                   LSEVKAQSSVGTPGFSFRWNNTKDFKKLYYVISNQERDTWSDYTLILKGKDRKAAIIKL
FT                   DVTVPSYFDTTINPKEVALKYCSVGSALSRTRCKETIPATVELANDGKTLEIFPDSPVP
FT                   PNKAIGVVFPVYNPGSGMYQFNALAQAPGDVPMAGYLGSWVIEITDGIDG"
     atgacaacgg gagaaggtgc agagcctcat gagaatcaac ccactgatgt tgggcatctc        60
     atggctctgc gactgcgcac cgtgcttggc ctggggggag ccgctgccct ggcaggcgga       120
     attgccctga gcggcttgag cgaggtgaag gcccagagct cagtgggcac ccctggtttc       180
     tcctttcgct ggaacaacac caaggacttc aaaaagctct attacgtcat ttccaaccag       240
     gaacgcgaca cctggtcgga ctacacgctg atcctcaaag gcaaagaccg caaggccgcg       300
     atcatcaagc tcgatgtgac cgtgccctcc tacttcgaca ccaccatcaa tcccaaggaa       360
     gtggccttga agtattgctc ggtgggtagt gctctttcgc gcacccgctg caaggaaacg       420
     atcccggcca ccgtggagct agccaacgac ggcaaaaccc tggagatctt cccggacagc       480
     cccgttcctc ccaacaaggc catcggcgtg gtcttccccg tctacaaccc cggcagcggc       540
     atgtatcagt tcaatgccct ggctcaagcc cctggcgatg tgcccatggc tggttatttg       600
     ggcagctggg taattgagat caccgacggc atcgacggct aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page