(data stored in ACNUC29543 zone)

EMBL: CT978603.PE654

CT978603.PE654       Location/Qualifiers
FT   CDS_pept        593122..594312
FT                   /transl_table=11
FT                   /gene="SynRCC307_0654"
FT                   /locus_tag="SynRCC307_0654"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27557"
FT                   /db_xref="GOA:A5GRP8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP8"
FT                   /protein_id="CAK27557.1"
FT                   /translation="MPISERLGQLGSGVFGRVDGEKRSYRLSQQQPQRPLIDLSLGSSD
FT                   LKPPVRLLQVMAEAIAEPPSSRYCLQAATAPFRQAAAAWLEGRFGVAVDPEKEILLLVG
FT                   SQEGTAHLPLAVLNPGDPALVLDPSYPSHAGGVALASGELVRLPLLADQGWRPAFEQLS
FT                   DEQRRQLRLLVLGYPHNPTATTGSQEWLEQAMAIAKRSDAVLAHDNPYVDLALEGEAPA
FT                   LLRCDGWRERGIEFFSFSKGWGLAGFRLAFAVGAPALIEALARVKGVVDFNQSLALQAG
FT                   AIAALQEFPDWPRQLCDRYRQRRDHMAELLTAAGWTVPNSSMALYQWLPIPEPLHDLGS
FT                   EAAAQWLLRSSGVALTPGVGFGPSGEGWLRLALVADEPVLEQASARLRLALEQRTI"
     atgcccatct ctgagcgtct cgggcaactg ggctccggcg tttttggccg ggttgacggt        60
     gaaaaacgca gttaccgcct ctcgcagcaa cagccgcagc gtccgctgat tgatctgtcg       120
     ctggggagct ctgatctcaa gcctcccgtt cggctcttgc aggtgatggc cgaagcgatc       180
     gctgagcccc ccagcagccg ctattgcttg caggctgcca ccgctccgtt tcgccaggcc       240
     gcggccgcct ggctcgaggg gcgcttcggt gtggccgtgg atccggagaa ggaaattctg       300
     ctgttggtgg gttcccagga gggcaccgcc catctgccgt tggcggtgct caatcccggc       360
     gatccggcct tggtgctgga tcccagctac cccagccatg ccggtggggt ggccctggct       420
     tccggtgagt tggtgcgttt gccgctgttg gctgatcagg gctggcgtcc agcctttgag       480
     cagctcagcg atgagcagcg gcggcagttg cgtttgttgg tgctgggcta tccccataac       540
     cccacggcca ccacgggttc gcaggagtgg ctcgagcagg ccatggccat cgccaaacgc       600
     agtgatgcgg tgctggccca cgacaacccc tatgtcgatt tggctctgga aggggaggct       660
     ccagcgttgc tgcgctgtga tggctggcgt gagcggggca ttgagttttt ctccttctcc       720
     aaaggctggg gcctggctgg atttcgcctg gcgtttgctg tgggcgctcc ggccttgatc       780
     gaggccttgg cccgggtcaa aggggtggtg gatttcaacc agtcgctggc cttgcaggct       840
     ggagccattg cggcactgca ggagttcccg gattggccgc ggcaattgtg cgatcgctac       900
     cgccagcgcc gcgaccacat ggccgaattg ctcacggccg ctggttggac ggtgcccaac       960
     agctcgatgg cgctttacca gtggcttccc atcccagaac ccctgcatga tctcggcagt      1020
     gaagcggcgg cccagtggct gctgcgcagc agtggtgtgg cgctcacgcc aggggtgggc      1080
     tttggcccca gcggggaagg ctggctgcgg ctggcgctgg tcgccgatga accggtgttg      1140
     gagcaggcca gtgcacgcct gcggttggcc ctggagcaac gcacaatctg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page