(data stored in ACNUC29543 zone)

EMBL: CT978603.PE664

CT978603.PE664       Location/Qualifiers
FT   CDS_pept        603168..604070
FT                   /transl_table=11
FT                   /gene="SynRCC307_0664"
FT                   /locus_tag="SynRCC307_0664"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27567"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ8"
FT                   /protein_id="CAK27567.1"
FT                   /translation="MRQRLTRRHWMLLAGSGLLAACSGTSQKLVVQQGLVPSAWLRRLP
FT                   RSWRAESLDWRQSLPAWPSGSRCLALTDGWAMANQPLAAQAWPQEALDGLLPLAQPLLP
FT                   FGLPVGFGPWLLVLRNRRDLLAGGGAERGWSLLLDPSLRQQVVLPASARVVEEIARRIG
FT                   DPAESLARLRQQALGFGDHDALTLLLHGDAQAAVLPSRAVIPQLSRDTRLQALLPESGA
FT                   PLWWALLQQTAQGEAPPVEWLLNPRRSPLLDQLLRAGFTPPLDRPRLQAALARQPHAEL
FT                   LLPPAEVLQRCTSLLPLAP"
     atgagacagc ggctgacccg gcgccattgg atgctgttgg cgggcagtgg cttgctggca        60
     gcctgctccg gcacgagcca gaagctggtg gtgcaacagg gcctagtgcc ttccgcatgg       120
     ctgcggcgtt tgccgcgcag ttggcgggcg gaatccctcg attggcgcca gagcttgccg       180
     gcttggccca gcggcagccg ttgcctggcc cttaccgatg gctgggcgat ggccaaccag       240
     ccgctggctg cgcaggcttg gccgcaagag gcccttgatg ggctgttgcc tttggcccaa       300
     cccctgctgc cctttggcct gcccgtgggg tttggccctt ggctgttggt gctgcgcaac       360
     cgccgcgatc tgcttgccgg cggcggggcg gagcggggct ggtcattgct gctggatccc       420
     agcctgcgtc agcaagtggt gttgcccgcc agcgcgcgcg tggtggaaga gattgccagg       480
     cgcattggtg atccggctga gagcctggcc cgtttgcgtc agcaggccct gggctttggt       540
     gatcacgatg cgctcaccct gctgctgcat ggcgatgctc aagcggccgt cttgccaagc       600
     cgcgcggtga ttccccagct cagccgcgac acccgcttgc aggcgctgct gccagagagt       660
     ggtgctccgc tgtggtgggc tctgctgcaa caaacggccc agggggaggc accgccggtg       720
     gagtggctgc tgaacccgcg ccgttcaccg ctgctggatc aattgctgcg cgctggattc       780
     acgccgccgc tggacaggcc aaggctgcag gccgccttgg cccgccaacc ccacgccgag       840
     ctgctgctgc cacccgctga ggtgttgcag cgctgcacca gcctgttgcc cttagcccca       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page