(data stored in ACNUC29543 zone)

EMBL: CT978603.PE673

CT978603.PE673       Location/Qualifiers
FT   CDS_pept        610760..611662
FT                   /transl_table=11
FT                   /gene="SynRCC307_0673"
FT                   /locus_tag="SynRCC307_0673"
FT                   /product="Uncharacterized protein required for cytochrome
FT                   oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27576"
FT                   /db_xref="GOA:A5GRR7"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRR7"
FT                   /protein_id="CAK27576.1"
FT                   /translation="MGLGVLSIPNSRSPFTALSLSRQLVVALIALVAIGGATRVMEAGL
FT                   ACPDWPLCYGSLLPAKQMSLQVFLEWFHRLDAFFVGIGLIVLLAMALIDRDQLPRWLPW
FT                   VSGLALLLVALQGALGALTVTQLLRFDIVSAHLATALLLVALLSGTAQMLQPLAVAPRP
FT                   PLAQPLCAAAGVVLYGQCIAGALMATQWASGRCLRLAEGCAWLSAHRSLATPAAALALL
FT                   SVLLVLALPSPKPARRLLTLAGVLVAAQVLLGVLTLRLSLSEPLVTVGHQLVAALLIAT
FT                   FSAAAVALRPAPSPALRHG"
     atgggccttg gcgtcctgtc aattccgaac agccgttcac cgttcacggc cctgtcgctt        60
     tcccggcagt tggtggtggc gctgatcgcc ttggtggcga tcggtggtgc aacgcgggtg       120
     atggaggctg gtctggcttg cccggattgg cccctttgct acggcagctt gttgccggcc       180
     aagcagatga gcctccaggt gtttctggag tggttccatc gcctcgatgc cttctttgtg       240
     ggcattggtc tgatcgtctt gctggccatg gcactgatcg atcgcgatca gctgccgcga       300
     tggctccctt gggtgagtgg tttggcgctg ctgttggtgg cgctgcaggg agccctcggc       360
     gccctgacgg tgacccagct gctgcgtttt gacatcgtca gcgcccatct ggccactgcc       420
     cttttgttag tggccttgct cagcggcact gctcagatgt tgcagccgct tgcggtggct       480
     cctcggcccc cgctggctca accgctctgc gccgccgccg gagttgtgct ctacggccaa       540
     tgcattgctg gcgccctcat ggccacccag tgggcttcag ggcgttgcct gcgcttggcc       600
     gaaggctgcg cttggctctc ggcccaccgc agcttggcca cccccgcagc ggccttggcc       660
     ctgctcagcg tgctgttggt tttggccctg cccagcccga aacccgcccg gcgcctgttg       720
     acgttggccg gggttttggt ggcagctcag gtgctcttgg gtgttctcac cctgcgcctg       780
     tcgctgtctg agcccctggt caccgttggc caccaattgg tggcggcgtt gttgatcgcc       840
     accttctcgg cggctgccgt cgccctacgg cctgctccat cacctgcttt gcgtcatggc       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page