(data stored in ACNUC29543 zone)

EMBL: CT978603.PE677

CT978603.PE677       Location/Qualifiers
FT   CDS_pept        614533..614943
FT                   /transl_table=11
FT                   /gene="SynRCC307_0677"
FT                   /locus_tag="SynRCC307_0677"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0677"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27580"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS1"
FT                   /protein_id="CAK27580.1"
FT                   /translation="MPAVFVSPRLRERQLREALQEALQQQDAQALRQLSDRLVHRHGPV
FT                   QLQRWIQALASDPQQLFWRQALAQPSKPVPQPSIALEEPPVVEEHPIAEESAPPVEETL
FT                   EQPPVPAPAPIKTALQGWLPQWDGPQIDRLAS"
     gtgcctgctg tctttgtttc gccccgcctg cgtgagcgtc aactccggga agctctgcaa        60
     gaagccctcc aacagcagga cgctcaagcg ctgcgccagc tgagtgatcg cctggtccat       120
     cgccatggcc ccgttcaact gcagcgttgg attcaggccc tcgccagcga tccgcagcaa       180
     ctgttctggc gccaggcctt ggcccagcca tccaagcccg tgccgcagcc cagcattgcg       240
     ctggaagagc cccctgtggt tgaggagcac cccatcgctg aagaaagtgc tccgccagtt       300
     gaagagacgc tggaacagcc tccagtgccg gctccggcgc cgatcaaaac ggcattgcag       360
     ggatggttgc cccagtggga tggcccccaa atcgaccgcc tcgcctcgtg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page