(data stored in ACNUC29543 zone)

EMBL: CT978603.PE688

CT978603.PE688       Location/Qualifiers
FT   CDS_pept        complement(622873..623700)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0688"
FT                   /locus_tag="SynRCC307_0688"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0688"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27591"
FT                   /db_xref="GOA:A5GRT2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT2"
FT                   /protein_id="CAK27591.1"
FT                   /translation="MLQARTALGLSREQLAERLHMRPHQIEALECHQQERWPEAVFTIA
FT                   QVRRLAAALGLDAEPVVEAFRADLSQQTNEASPAAKAVFQLGRSEPTAQAKREEGQRDW
FT                   LHESKKDNKTKAKASPVRFQRPNWLVPSIGVVALLAIGGVAISRNLPALQGQLAAIPKL
FT                   WPKTPAKPSADAAVAATPKPQPKTLELSLSEPVWMSVRQLAGQKQLFEGLMQPGPHSFP
FT                   LGTGVQVLAGRPDLVMAHIGDQPAKALGSIETIQWVTFKPPVAAASATAPNAG"
     ttgctccaag cgcgtaccgc cttaggtctg agccgcgagc aactggccga gcggctgcac        60
     atgcggccgc atcagatcga agcgctcgaa tgccatcaac aggaacgctg gccagaggcg       120
     gtgttcacca ttgcccaagt cagacgcttg gccgcggccc tcggccttga tgccgaaccg       180
     gtggtcgaag ccttccgggc cgacttgagc caacaaacca acgaggccag ccccgccgcc       240
     aaagcggtat ttcagctggg ccgctcggaa cccacagccc aagccaaacg ggaagagggc       300
     caacgggatt ggctgcatga gagcaagaaa gacaacaaaa ccaaagccaa agccagcccg       360
     gttcgtttcc agcggcccaa ctggcttgtg ccctccattg gagttgtcgc gctgttggcc       420
     atcggcggcg tcgccatcag ccgcaatctg ccggctctgc aaggccaatt ggctgccatc       480
     cccaagctgt ggccgaaaac accagccaaa cccagtgctg atgctgctgt tgccgccacc       540
     ccaaaaccgc agcccaaaac gttggagctc tcactcagtg agccggtctg gatgtcagtg       600
     cgtcagctgg cgggccaaaa gcagttgttt gaaggcctca tgcagcctgg cccccacagc       660
     ttcccgctcg gcactggcgt gcaggtctta gcgggacgcc ctgatctggt gatggcccac       720
     atcggcgatc agccagccaa agccctgggc tcgattgaaa cgatccagtg ggtgaccttt       780
     aaaccgccag tggctgccgc gagcgcaaca gctccgaacg caggctaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page