(data stored in ACNUC29543 zone)

EMBL: CT978603.PE689

CT978603.PE689       Location/Qualifiers
FT   CDS_pept        623692..623862
FT                   /transl_table=11
FT                   /gene="SynRCC307_0689"
FT                   /locus_tag="SynRCC307_0689"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0689"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27592"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT3"
FT                   /protein_id="CAK27592.1"
FT                   /translation="MEQNCSWIGGGSSVQRLVLIAHSKATQQWANCGPGSPTLLEALST
FT                   TTTNSWLGMLL"
     ttggagcaaa actgctcctg gattggaggg ggcagcagcg ttcagcggtt ggttctgatc        60
     gcccattcca aagcaacgca gcagtgggcg aattgtggcc caggttcacc aactttgctt       120
     gaagcgttaa gcacaacaac caccaattct tggcttggaa tgttgctcta a                171
//

If you have problems or comments...

PBIL Back to PBIL home page