(data stored in ACNUC29543 zone)

EMBL: CT978603.PE695

CT978603.PE695       Location/Qualifiers
FT   CDS_pept        complement(627966..628187)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0695"
FT                   /locus_tag="SynRCC307_0695"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0695"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27598"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRT9"
FT                   /protein_id="CAK27598.1"
FT                   /translation="MATDWGMSERQAYRYLKEARAVIIEDIDKDRRDVVAEAIATCRMV
FT                   IREASKAGQYNNVIGAVNALSRLGKLDA"
     atggcgactg actgggggat gagcgagcga caggcgtacc gctatctcaa ggaagcacgg        60
     gctgtgatca ttgaagacat cgacaaggac cgaagggatg tggtcgcaga agccattgcc       120
     acctgccgca tggtcatacg agaagccagc aaggcagggc agtacaacaa cgtgattggg       180
     gctgttaacg ccctgtccag gcttggcaaa ctcgacgcct ag                          222
//

If you have problems or comments...

PBIL Back to PBIL home page